KEGG   Pseudomonas putida F1: Pput_4229Help
Entry
Pput_4229         CDS       T00537                                 

Definition
chemotaxis-specific methylesterase
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
ppf  Pseudomonas putida F1
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Pput_4229
Enzymes [BR:ppf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Pput_4229
Two-component system [BR:ppf02022]
 CheA family
  WspE-WspRF
   Pput_4229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4731450..4732463)
Genome map
AA seq 337 aa AA seqDB search
MKIAIVNDMPLAVEALRRAVALEPAHQVVWVASNGAEAVQRCTEQLPDLILMDLIMPVMD
GVEATRRIMAETPCAIVIVTVDRKQNVHRVFEAMGHGALDVVDTPALGAGDAREAAAPLL
RKILNIGWLVGQQRAPAARSVAAPLREASQRRGLVAIGSSAGGPAALEVLLKGLPAAFPA
AIVLVQHVDQVFAAGMAEWLSSAAGLPVRLAREGEPPQPGQVLLAGTNHHIRLLQSGQLA
YTAEPVNEIYRPSIDVFFESVARYWNGDAVGVLLTGMGRDGAQGLKLMRQQGFLTIAQDQ
ASSAVYGMPKAAAAIDAAVEIRPLERIAGRLTEFFAK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgccatcgtcaatgacatgcccctggccgtcgaagcgttgcgccgggcggtt
gccctggagcccgcacaccaggtcgtgtgggtggccagcaacggtgccgaggcggtgcag
cgctgcaccgagcagttaccggacctgatcctcatggacctgatcatgccggtgatggac
ggtgtcgaggcgacccggcggatcatggccgaaaccccgtgcgccattgtcatcgtcacg
gtcgaccgcaagcagaacgtacaccgggtattcgaggccatgggccatggcgcgctcgat
gtggtcgacacgcctgcgctgggcgctggcgatgcccgcgaagcagcggcgccattgctg
cgcaagatcctcaatatcggctggctggtcggccagcagcgtgcacctgccgcaaggtcg
gtggctgcaccgctgcgcgaggcttcccagcgccgcgggttggtggcaatcgggtcttcg
gcgggggggccggcagcactcgaagtgctgctcaagggtttgccggccgcgtttccggcg
gccatcgtgctggtccagcacgtggaccaggtgtttgccgcaggcatggccgaatggctc
agcagcgcagcaggcctgccggtgcgcctggcccgtgaaggcgaaccgccgcagccaggg
caggtactcctggccggtaccaaccaccacattcgcctgctacagagcggccaactggcc
tacactgccgaacctgtgaatgaaatctaccggccctcgatcgatgtgttctttgagagc
gtggcacgttactggaatggtgatgcggtgggcgtgctgctcaccggcatgggccgcgac
ggtgcccagggcctgaagctgatgcgtcagcagggctttctgaccattgctcaggaccag
gccagcagcgcggtgtacggcatgcccaaggctgctgcggctattgatgccgcggtggag
attcgcccgctggaacgcatagccgggcgcttgactgaatttttcgcaaaatga

DBGET integrated database retrieval system