KEGG   Pseudomonas putida F1: Pput_4250Help
Entry
Pput_4250         CDS       T00537                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ppf  Pseudomonas putida F1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pput_4250
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pput_4250
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pput_4250
Enzymes [BR:ppf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pput_4250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4753316..4754725)
Genome map
AA seq 469 aa AA seqDB search
MRYISTRGQAPALNFEDVLLAGLASDGGLYVPENLPRFTQEEIASWAGLPYHELAFRVMR
PFVEGSIADADFKKILEETYGEFAHAAVAPLRQLNSNEWVLELFHGPTLAFKDFALQLLG
RLLDHVLAKRNERVVIIGATSGDTGSAAIEGCRRCDNVDIFILHPHQRVSEVQRRQMTTI
FGDNIHNIAIEGNFDDCQEMVKASFADQSFLKGTRLVAVNSINWARIMAQIVYYFHAALQ
LGGPARSVAFSVPTGNFGDIFAGYLARNMGLPVSQLIVATNRNDILHRFMSGNQYVKETL
HATLSPSMDIMVSSNFERLLFDLHGRNGGAIAELMANFKQGGGFSVEQDRWTEARKLFDS
LAVSDEQTCETIAEVFAATGEVLDPHTAIGVKAARECRRSLDTPMVVLGTAHPVKFPDAV
EKAGVGKALELPAHLSDLFSREERCTVLANDLKAVQGFVSQHGNRGKPL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatcagtacccgcggccaggcaccggccctgaatttcgaagacgtgctgctg
gctggcctggccagcgacggcggcctctacgtgccggaaaacctgccacgcttcactcag
gaagaaatcgcctcgtgggccggcttgccctaccacgagctggccttccgcgtgatgcgt
ccgttcgtcgagggcagcatcgccgacgccgatttcaagaagatcctcgaagaaacctac
ggcgagttcgcccacgctgcggtcgccccgttgcgtcagctgaacagcaacgagtgggtg
ctggagctgttccacggcccgaccctggcgttcaaggactttgccctgcagttgctcggt
cgcctgcttgaccatgtgctggccaagcgcaacgagcgcgtggtcatcatcggtgccacc
agcggtgataccggttccgctgcaatcgaaggctgccgccgttgcgacaacgtcgacatc
ttcatcctgcacccgcaccagcgtgtatcggaagtgcagcgccgtcagatgactaccatc
tttggcgacaacatccacaacatcgccatcgaaggcaacttcgacgactgccaggaaatg
gtcaaggccagtttcgccgaccagtcgttcctcaagggcacccgcctggtcgccgtcaac
tcgatcaactgggcgcggatcatggcccagatcgtctactacttccatgcagccctgcag
ctgggcggcccggcgcgctcggtggcgttctcggtaccaaccggcaacttcggcgacatc
ttcgccggctacctggcgcgcaacatgggcctgccggtcagccaattgatcgtcgccacc
aaccgcaacgacatcctgcaccgcttcatgagcggcaaccagtacgtcaaggaaaccctg
cacgcgaccctgtcgccgtcgatggacatcatggtctcgtccaacttcgagcgcctgctg
ttcgacctgcatggccgcaacggtggtgcgattgccgagctgatggccaacttcaagcaa
ggtggtggcttcagcgtcgagcaagaccgctggaccgaagcccgcaaactgttcgactcg
ctggctgtcagcgacgagcaaacctgcgagaccatcgcagaagtgttcgccgccaccggt
gaagtgctcgacccgcataccgcaatcggcgtgaaggctgcccgcgagtgccgccgcagc
ctggacacgccaatggtggtgctgggtaccgcgcacccggtcaagttcccggacgcggtg
gagaaggccggtgtgggcaaggcgctggagctacccgcgcacctcagcgacctgttcagc
cgtgaagagcgttgcacggtcctggccaatgacctgaaggctgtacagggctttgtcagc
cagcacggcaaccgcggcaagccgctgtaa

DBGET integrated database retrieval system