KEGG   Pseudomonas putida F1: Pput_4250Help
Entry
Pput_4250         CDS       T00537                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00260  Glycine, serine and threonine metabolism
ppf00750  Vitamin B6 metabolism
ppf01100  Metabolic pathways
ppf01110  Biosynthesis of secondary metabolites
ppf01120  Microbial metabolism in diverse environments
ppf01230  Biosynthesis of amino acids
Module
ppf_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pput_4250
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pput_4250
Enzymes [BR:ppf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pput_4250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP URO-D
Motif
Other DBs
NCBI-ProteinID: ABQ80374
JGI: Pput4250
UniProt: A5W8B4
Position
complement(4753316..4754725)
Genome map
AA seq 469 aa AA seqDB search
MRYISTRGQAPALNFEDVLLAGLASDGGLYVPENLPRFTQEEIASWAGLPYHELAFRVMR
PFVEGSIADADFKKILEETYGEFAHAAVAPLRQLNSNEWVLELFHGPTLAFKDFALQLLG
RLLDHVLAKRNERVVIIGATSGDTGSAAIEGCRRCDNVDIFILHPHQRVSEVQRRQMTTI
FGDNIHNIAIEGNFDDCQEMVKASFADQSFLKGTRLVAVNSINWARIMAQIVYYFHAALQ
LGGPARSVAFSVPTGNFGDIFAGYLARNMGLPVSQLIVATNRNDILHRFMSGNQYVKETL
HATLSPSMDIMVSSNFERLLFDLHGRNGGAIAELMANFKQGGGFSVEQDRWTEARKLFDS
LAVSDEQTCETIAEVFAATGEVLDPHTAIGVKAARECRRSLDTPMVVLGTAHPVKFPDAV
EKAGVGKALELPAHLSDLFSREERCTVLANDLKAVQGFVSQHGNRGKPL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatcagtacccgcggccaggcaccggccctgaatttcgaagacgtgctgctg
gctggcctggccagcgacggcggcctctacgtgccggaaaacctgccacgcttcactcag
gaagaaatcgcctcgtgggccggcttgccctaccacgagctggccttccgcgtgatgcgt
ccgttcgtcgagggcagcatcgccgacgccgatttcaagaagatcctcgaagaaacctac
ggcgagttcgcccacgctgcggtcgccccgttgcgtcagctgaacagcaacgagtgggtg
ctggagctgttccacggcccgaccctggcgttcaaggactttgccctgcagttgctcggt
cgcctgcttgaccatgtgctggccaagcgcaacgagcgcgtggtcatcatcggtgccacc
agcggtgataccggttccgctgcaatcgaaggctgccgccgttgcgacaacgtcgacatc
ttcatcctgcacccgcaccagcgtgtatcggaagtgcagcgccgtcagatgactaccatc
tttggcgacaacatccacaacatcgccatcgaaggcaacttcgacgactgccaggaaatg
gtcaaggccagtttcgccgaccagtcgttcctcaagggcacccgcctggtcgccgtcaac
tcgatcaactgggcgcggatcatggcccagatcgtctactacttccatgcagccctgcag
ctgggcggcccggcgcgctcggtggcgttctcggtaccaaccggcaacttcggcgacatc
ttcgccggctacctggcgcgcaacatgggcctgccggtcagccaattgatcgtcgccacc
aaccgcaacgacatcctgcaccgcttcatgagcggcaaccagtacgtcaaggaaaccctg
cacgcgaccctgtcgccgtcgatggacatcatggtctcgtccaacttcgagcgcctgctg
ttcgacctgcatggccgcaacggtggtgcgattgccgagctgatggccaacttcaagcaa
ggtggtggcttcagcgtcgagcaagaccgctggaccgaagcccgcaaactgttcgactcg
ctggctgtcagcgacgagcaaacctgcgagaccatcgcagaagtgttcgccgccaccggt
gaagtgctcgacccgcataccgcaatcggcgtgaaggctgcccgcgagtgccgccgcagc
ctggacacgccaatggtggtgctgggtaccgcgcacccggtcaagttcccggacgcggtg
gagaaggccggtgtgggcaaggcgctggagctacccgcgcacctcagcgacctgttcagc
cgtgaagagcgttgcacggtcctggccaatgacctgaaggctgtacagggctttgtcagc
cagcacggcaaccgcggcaagccgctgtaa

DBGET integrated database retrieval system