KEGG   Pseudomonas putida F1: Pput_4493Help
Entry
Pput_4493         CDS       T00537                                 

Definition
short chain dehydrogenase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
ppf  Pseudomonas putida F1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ppf00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ppf00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5017544..5018281
Genome map
AA seq 245 aa AA seqDB search
MLGGNQRTDKLTTPNMNSPILVTGASQRVGLALALELAQAGHTVVSASRSILPQAAHPNI
VQFQADLCQADDRQALIDHLHDRYDGLRAIIHNASLWLDDGLDNLETMFRLHVEAPYHLN
LALGDLLAKVEKADIIHICDETSSRGSKSHIGYAATKAALQNMVLSFAEKYAPKVRVNGI
LPGLLILKEGGDEAYRQQTLKKALLEFEPGAGPLIETVKYLLASQYSTGSQVVINGGRHL
KNRMT
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgctgggtggcaaccaaaggacagacaagttgaccaccccgaacatgaacagccccatt
ctcgttaccggagccagccagcgtgtcgggctggccctggccctcgaactggcacaggcc
ggccatacggtggtcagtgccagccgcagcatcctgccccaggcagcccaccccaacatc
gtgcagtttcaggccgacctgtgccaggcggacgaccgccaggcgctgatcgatcacctg
cacgatcgttacgacggactgcgcgccatcatccacaacgcctcgctatggctcgacgac
ggcctcgacaacctcgagaccatgttccgcctgcacgtcgaagcgccctaccacctcaac
ctggccctgggcgacctgctggccaaggtggaaaaggccgacatcattcacatctgcgac
gaaacctcttcgcgcggcagtaaaagccacatcggctacgccgccaccaaggccgcactg
cagaacatggtgctgtcatttgctgaaaaatatgcgcccaaggtgcgtgtgaacggtatc
ctgcccgggctgctgatcctcaaggaagggggtgacgaagcctaccgccagcaaaccctg
aaaaaggccctgctggaattcgaacccggcgccggcccgctgatcgagaccgtcaagtac
ctgctcgccagccagtacagcaccggcagccaggtggtcatcaacggtggccgccacctg
aagaaccgcatgacttga

DBGET integrated database retrieval system