KEGG   Pseudomonas putida F1: Pput_4536Help
Entry
Pput_4536         CDS       T00537                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ppf  Pseudomonas putida F1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ppf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5061665..5063740)
Genome map
AA seq 691 aa AA seqDB search
MSRSLVDLLPTPLHAEHLLALAPQHNSADLLQLLDRWVERGWLRALDRAFVSFLEERAPG
SDPLLLLAAALASHQLGHGHVCLDLQQTLAEPDFALSLPPEGDALIGPLLLPSQLLANLD
LNAWLQRIIASPLVAAGDTPGQQARPLVRSGERLYLRRYWRYERRIDHALRQRLSQAEAP
PADLPERLAQLFEGGAPAGQVDWQKLACALATRAGFSIITGGPGTGKTTTVVRLLALLQA
PAVEQGRPLRIRLAAPTGKAAARLTESIGQQVERLQVSAEVRGQIPTEVSTVHRLLGSRP
GSRHFRHHAGNPLPLDVLVVDEASMIDLEMMANLLDALPPRARLVLLGDKDQLASVEAGA
VLGDLCRDAEEGFYSPATAAWLQQVSGESLAGSGLKAGDEQRHPLAQQVVMLRFSRRFGE
GSGIGQLARLVNRQDAHAARNLLAAPPADVHSLSLKHEQDRAFDRLLLDGLNRGTDGPHG
YRSYLRTLGRYRPALDTAFDDPAWEQWAGKVLRSFEDFQLLCAVRRGAWGVEGLNERVAR
VLHNAGLIDSQQPWYEGRPVLVTRNDYGLGLMNGDIGIALRLPDEQGQPLLRVAFPRNDG
SGGVRFVLPSRLNEVETVFAMTVHKSQGSEFSHTALVLPDALNPVLTKELVYTGITRAKH
CFSLVEPRQGIFEEAVARKVRRISGLMLEQV
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgagccgaagccttgtcgacctgttgcccaccccgttgcacgcagagcacctgctggcg
ctggcaccgcagcacaacagcgctgatttgctgcaattactcgaccgctgggttgagcgg
ggctggctacgtgccctggaccgcgcgttcgtgtcgttcctggaagagcgtgcccccggc
agtgatcccttactattgctggcagcggcgctggccagccaccaactggggcacggacat
gtctgcctcgacctgcaacaaaccttggccgagccggatttcgccctgtcgttgccgccg
gaaggtgacgcccttatcggccctttgctactgccatcgcaactgctggccaaccttgac
ttgaatgcctggcttcagcgcatcatcgccagcccgctggtggccgcaggtgatacgcct
ggccagcaggcgcggccactggtacgcagtggcgagcgcctttacctgcgccgttactgg
cgttacgagcggcgcattgaccatgccctgcgccagcgcctgagtcaggccgaagcaccg
cctgcggacctgccagagcgcctggcgcaactgttcgagggcggcgcgccagctggccag
gtggactggcagaagcttgcctgcgccttggccacccgggccggtttcagcatcatcacg
ggtggccccggcaccggcaagacgaccaccgtggtgcgcctgctggcgttgctgcaggcg
ccggcagtggagcagggtaggccactgcgcatccgcctggctgcaccgaccggcaaggcc
gctgcgcgcctgaccgaatccattggccagcaagtcgagcgcctgcaagtcagcgccgaa
gtacgcgggcaaatccccactgaagtcagcaccgtgcatcgtctgctcggaagccgcccg
ggctcgcggcacttccgccaccacgctggcaacccgttgccgttggatgtgctggtggtc
gatgaggcgtcgatgatcgacctggaaatgatggccaacctgctcgatgccttgccgccg
cgggcgcgtctggtgctgctgggcgacaaggaccagttggcctcggtcgaggccggcgcg
gtactgggtgacctgtgccgggatgctgaggagggcttttactcgccggcgactgcagcg
tggcttcagcaggtcagtggcgagtcgctggccggcagtggcctcaaggccggcgatgag
cagcgccacccgttggctcagcaagtggtgatgctgcggttttcacggcgtttcggtgaa
ggcagcggtattggccagttggccagactggtcaatcgtcaggatgctcacgcggcgcgc
aacctgctggccgcgccgcctgctgacgtgcacagcctgtcgctcaagcacgagcaggat
cgtgcttttgaccgcctgttactggacggtctgaaccgcggtaccgatggaccgcacggc
taccgcagctacctgcgcacccttgggcgttaccggccagcacttgataccgcctttgac
gaccccgcctgggagcaatgggcgggcaaggtgttgcgcagtttcgaggatttccagttg
ctgtgcgcggtgcgccggggcgcctggggggtcgaaggcctgaatgaacgggtggcgcgg
gtgctgcacaatgccggtctgatcgacagccagcaaccttggtacgaagggcgcccggtg
ctggtgacccgcaacgactacggtctgggcctgatgaatggtgacatcggtatagccctg
cgcttgccggatgagcagggccagccgctgctgcgtgtggccttcccgcgcaacgacggc
agtggtggtgtgcggttcgttctgccgagccggctcaacgaagtggaaacggtattcgcc
atgaccgtgcacaagtcccagggctcggagttcagccacactgccctggtgctgccggat
gcgctcaacccggtgctgaccaaggaactggtgtacaccggcatcactcgggccaagcac
tgcttcagcctggtcgagccacgccaaggcattttcgaagaagcggtggcgcgcaaagta
cggcgtatttccgggttgatgctcgagcaggtctag

DBGET integrated database retrieval system