KEGG   Pseudomonas putida F1: Pput_4563Help
Entry
Pput_4563         CDS       T00537                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ppf  Pseudomonas putida F1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pput_4563
Enzymes [BR:ppf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Pput_4563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5104103..5104582
Genome map
AA seq 159 aa AA seqDB search
MTIRAYVGLGSNLDAPAEQLRSALQALDQVEATRLVAASALYTSDSLLPGQPRYTNAVAA
LDTALAPLALLDALQAIENDQGRVRKERWGPRTLDLDILLFGDQVLDQPRLKVPHYHMHA
RPFVLYPLAELVPGDFRLADGRALAQLLDECPFVGLERL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgaccattcgcgcctacgtaggcctgggcagcaacctggacgcacctgccgagcagttg
cgtagcgccttgcaggcgctggaccaggtcgaagccacgcgcctggtagccgcctcggcc
ctgtacaccagtgattcgctgctgcccggccaaccgcgctacaccaacgctgtcgccgcc
ctggacaccgccctggcgccactggcattgctcgatgcgttgcaggccatcgaaaacgac
cagggccgcgtgcgcaaggaacgctggggcccacgtacgctggacctggacatcttgctg
ttcggtgaccaggtgctcgaccagccacgcctgaaagtgccgcattaccacatgcatgcc
cgccccttcgtgctgtatccgttggccgagctggtaccgggcgatttccgcctggccgat
ggtcgtgccctcgcgcaactgctcgacgaatgcccattcgtcggcctggaacgcctgtag

DBGET integrated database retrieval system