KEGG   Pseudomonas putida F1: Pput_4563Help
Entry
Pput_4563         CDS       T00537                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ppf  Pseudomonas putida F1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ppf00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5104103..5104582
Genome map
AA seq 159 aa AA seqDB search
MTIRAYVGLGSNLDAPAEQLRSALQALDQVEATRLVAASALYTSDSLLPGQPRYTNAVAA
LDTALAPLALLDALQAIENDQGRVRKERWGPRTLDLDILLFGDQVLDQPRLKVPHYHMHA
RPFVLYPLAELVPGDFRLADGRALAQLLDECPFVGLERL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgaccattcgcgcctacgtaggcctgggcagcaacctggacgcacctgccgagcagttg
cgtagcgccttgcaggcgctggaccaggtcgaagccacgcgcctggtagccgcctcggcc
ctgtacaccagtgattcgctgctgcccggccaaccgcgctacaccaacgctgtcgccgcc
ctggacaccgccctggcgccactggcattgctcgatgcgttgcaggccatcgaaaacgac
cagggccgcgtgcgcaaggaacgctggggcccacgtacgctggacctggacatcttgctg
ttcggtgaccaggtgctcgaccagccacgcctgaaagtgccgcattaccacatgcatgcc
cgccccttcgtgctgtatccgttggccgagctggtaccgggcgatttccgcctggccgat
ggtcgtgccctcgcgcaactgctcgacgaatgcccattcgtcggcctggaacgcctgtag

DBGET integrated database retrieval system