KEGG   Pseudomonas putida F1: Pput_4567Help
Entry
Pput_4567         CDS       T00537                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00010  Glycolysis / Gluconeogenesis
ppf00620  Pyruvate metabolism
ppf00640  Propanoate metabolism
ppf00680  Methane metabolism
ppf01100  Metabolic pathways
ppf01110  Biosynthesis of secondary metabolites
ppf01120  Microbial metabolism in diverse environments
ppf01130  Biosynthesis of antibiotics
ppf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pput_4567
   00620 Pyruvate metabolism
    Pput_4567
   00640 Propanoate metabolism
    Pput_4567
  Energy metabolism
   00680 Methane metabolism
    Pput_4567
Enzymes [BR:ppf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Pput_4567
Lipid biosynthesis proteins [BR:ppf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Pput_4567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABQ80687
JGI: Pput4567
UniProt: A5W977
Position
5108559..5110493
Genome map
AA seq 644 aa AA seqDB search
MFDIRKYPQALAVSQSAALTPEDYRRLYRQSVEDPDTFWAEQAKRLDWIKPWSSVQQCDL
HTGKARWFDGAQLNVSYNCIDRHLAQRGEQTALLWEGDDPKDSKAITYRELHREVCRLAN
AMKARGVKKGDRVCIYMPMIPEAAFAMLACTRIGAIHSVVFGGFSPDALRDRILDADCRT
VITADEGVRGGKRIPLKQNVDKALASCPAVSSVLVVRRTGGDVAWTEGRDLWYHEATKDA
GDDCPPEPMEAEDPLFILYTSGSTGKPKGVLHTTGGYLLQATMTFKVVFDYRDGEVFWCT
ADVGWVTGHSYIVYGPLANGAISLMFEGVPNYPDTSRFWQVVDKHQVNIFYTAPTALRAL
MREGSAPLQGTSRKSLRLLGSVGEPINPEAWEWYFEEVGQKRCPIVDTWWQTETGGIMLT
PLPGTQSLKPGCATQPMFGVQPVLLDEKGKLIEGPGAGVLAIKASWPGQIRSVYGDHQRM
VDTYFKPLPGYYFTGDGARRDADGDYWITGRIDDVINVSGHRIGTAEVESALVLHDSVAE
AAVVGYPHDLKGQGVYAFVTTMNGVTPDDTLKAELLALVSKEIGSFAKPELIQWAPALPK
TRSGKIMRRILRKIACNELENLGDTSTLADPSVVQGLIDKRLNQ
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatatccgcaaatacccccaagccctggccgtcagccagtccgccgccctcacc
cccgaagactaccgccgcctctaccgccagtcggtcgaagacccagacaccttctgggcc
gaacaggccaaacgtctggactggatcaagccttggtcaagcgtgcagcaatgcgacctg
cataccggcaaggcccgctggttcgacggtgcgcaactcaacgtcagctacaactgcatc
gaccgtcatctggcccagcgcggcgagcaaacggccctgctgtgggaaggcgacgacccc
aaggattccaaggccatcacctatcgcgaactgcaccgtgaggtctgccgcctggccaac
gcaatgaaagcgcgcggtgtgaagaaaggcgaccgggtgtgcatctacatgccaatgatt
cccgaggccgccttcgccatgctcgcctgcacccgcatcggcgccatccactcggtagtg
ttcggcggtttctcccccgatgccttgcgagaccgtattctcgatgccgactgccgcacc
gtgatcaccgccgatgaaggcgtgcgtggcggcaaacgcatcccgctgaaacagaacgtc
gacaaggccctggccagctgccctgcggtcagtagcgtattggtggtgcgtcgcactggc
ggcgatgttgcgtggaccgagggccgcgacctctggtatcacgaagcgacgaaggatgcc
ggcgacgactgccccccagaaccgatggaggccgaagacccgctgttcatcctctacacc
tccggcagcaccggcaaacccaaaggggtgctgcataccaccggcggctacctgctgcag
gcaacgatgaccttcaaggtggtgttcgattatcgtgacggcgaggtgttctggtgcacc
gccgatgtcggctgggtgactggccacagctacatcgtctacggcccgctggccaatggc
gcaatctcgctgatgttcgaaggcgtgcccaactacccggatacctcgcgcttctggcag
gtggtggacaaacaccaggtgaacatcttctacaccgccccgaccgccctgcgcgcactg
atgcgcgagggctctgcgccactgcagggcacctcacgcaaaagcctgcgcctgctgggc
agcgtcggcgagccgatcaacccggaagcctgggaatggtatttcgaggaggtcgggcag
aagcgctgcccgattgtggatacctggtggcagaccgaaaccggcggcatcatgctcacc
ccgctgcccggcacgcagtcactcaaacccggctgcgctacccagccaatgttcggcgtg
cagccggtgctactggacgaaaaaggcaaactgatcgaaggccccggcgccggcgtgctg
gcgatcaaagccagctggccggggcagatccgcagtgtctacggcgaccaccagcggatg
gtcgacacctacttcaagcccttgcccggctactacttcacaggcgacggtgcccgccgc
gatgccgatggcgactactggatcaccgggcgcatcgacgatgtgatcaacgtatccggg
caccgcatcggcaccgctgaagtggaaagcgcacttgtgctgcatgacagcgtggccgaa
gccgcggtggtcggttatccccacgacctcaagggccaaggcgtctacgccttcgtcacg
accatgaatggcgtgacaccagatgacacgctaaaagccgagctgctggccctggtcagc
aaggaaatcggcagcttcgccaagcctgagctgattcagtgggcgccagcgctacccaag
acgcgctcaggcaagatcatgcggcgtatactgcgcaaaatcgcctgcaatgagctggaa
aacctgggcgatacctcgaccctggccgacccaagcgtggtacagggcctgatcgacaaa
cgcctcaaccagtaa

DBGET integrated database retrieval system