KEGG   Pseudomonas putida F1: Pput_4581Help
Entry
Pput_4581         CDS       T00537                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ppf  Pseudomonas putida F1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pput_4581 (tpiA)
   01230 Biosynthesis of amino acids
    Pput_4581 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pput_4581 (tpiA)
   00051 Fructose and mannose metabolism
    Pput_4581 (tpiA)
   00562 Inositol phosphate metabolism
    Pput_4581 (tpiA)
Enzymes [BR:ppf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pput_4581 (tpiA)
Exosome [BR:ppf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pput_4581 (tpiA)
  Exosomal proteins of bladder cancer cells
   Pput_4581 (tpiA)
  Exosomal proteins of melanoma cells
   Pput_4581 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5125580..5126335)
Genome map
AA seq 251 aa AA seqDB search
MRRPMVAGNWKMHGTRASVAELTKGLSNLALPSGVEVAVFPPALFINQVIDGLAGKEITV
GAQNSAVQPEQGALTGEVAPEQLVEAGCKLVLIGHSERRQIIGETDEVLNRKFAAAQAKG
LKPVLCIGETLEEREAGKTLEVVGRQLSSIIEAFGVKAFADAVIAYEPVWAIGTGLTATP
QQAQDVHAAIRGQLAAEDAEVAAKVQLLYGGSVKAANAAELFGMPDIDGGLIGGASLNAD
EFGAICRAAGN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgccctatggtagctggtaactggaaaatgcacggtacccgcgctagcgtcgct
gagctgaccaaaggcttgagtaatctcgccttgccgagcggagtggaagtcgccgtattt
ccaccagccttgttcatcaatcaggtgattgatggcctggcaggtaaagaaattactgtc
ggtgcacagaattctgctgtacaacccgaacagggtgcgctgaccggggaagttgctccc
gagcagctggttgaagcaggttgcaagttggtgttgattggccattcggagcgtcgccag
attattggtgaaaccgacgaagtgctcaatcgcaagtttgcagcagcccaggccaaaggc
ttgaagccagtgctttgcataggggaaacccttgaggagcgcgaggctggcaaaacgctc
gaagttgtcgggcgtcaactaagcagtatcatcgaagcattcggtgttaaggcttttgcc
gatgcagtaattgcctatgagcctgtatgggccatcggtacaggccttacggccacgcca
cagcaggcccaggatgtgcacgccgccatccgtggccagttggcggcagaagatgctgaa
gtggctgcgaaggtgcagttgctatacggcggcagcgtgaaggcggccaatgcggccgaa
ctgttcggcatgccggatatcgatggggggctcattggtggggcttccctgaacgcagac
gaattcggtgcaatttgtcgcgccgcaggaaactga

DBGET integrated database retrieval system