KEGG   Pseudomonas putida F1: Pput_5197Help
Entry
Pput_5197         CDS       T00537                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00010  Glycolysis / Gluconeogenesis
ppf00030  Pentose phosphate pathway
ppf00051  Fructose and mannose metabolism
ppf00052  Galactose metabolism
ppf00230  Purine metabolism
ppf00500  Starch and sucrose metabolism
ppf00520  Amino sugar and nucleotide sugar metabolism
ppf00521  Streptomycin biosynthesis
ppf01100  Metabolic pathways
ppf01110  Biosynthesis of secondary metabolites
ppf01120  Microbial metabolism in diverse environments
ppf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pput_5197
   00030 Pentose phosphate pathway
    Pput_5197
   00051 Fructose and mannose metabolism
    Pput_5197
   00052 Galactose metabolism
    Pput_5197
   00500 Starch and sucrose metabolism
    Pput_5197
   00520 Amino sugar and nucleotide sugar metabolism
    Pput_5197
  Nucleotide metabolism
   00230 Purine metabolism
    Pput_5197
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pput_5197
Enzymes [BR:ppf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Pput_5197
    5.4.2.8  phosphomannomutase
     Pput_5197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ABQ81315
JGI: Pput5197
UniProt: A5WB05
Position
5840458..5841858
Genome map
AA seq 466 aa AA seqDB search
MNDMAHLVPAALPDSIFRAYDIRGVVGKTLHAETAYWIGRAIGAQSLAQGEPQVSVGRDG
RLSGPMLVEQLIKGLVDAGCHVSDVGLVPTPALYYAANVLAGKSGVMLTGSHNPSDYNGF
KIVIAGDTLANEQIQALLTRLKTNDLTLAQGRVEKVEILDRYFQQIVGDVKLAKKLKVVV
DCGNGAAGVIAPQLIEALGCEVIPLFCEVDGNFPNHHPDPGKPENLEDLIAKVKETGADI
GLAFDGDGDRVGVVTNTGSIVYPDRLLMLFAQDVLSRNPGAEIIFDVKCTRRLTPLIEQH
GGSALMWKTGHSLIKKKMKQTGSLLAGEMSGHIFIKERWYGFDDGIYSAARLLEILSKTQ
QSAENLFAAFPNDISTPEINIDVTDEGKFSIIDALQRDADWGEAHLTTIDGVRVDYANGW
GLVRASNTTPVLVLRFEADSDAELQRIKDVFRTQLLRVEPELQLPF
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacatggcccacctggtccccgccgcattgcccgacagcattttccgcgcatat
gacatacgcggcgtggtcggcaagacccttcacgccgaaaccgcctactggatcggccgc
gccatcggcgcgcaaagcctggcccagggcgaaccgcaggtttcggtagggcgcgatggc
cgcctgtcgggcccgatgctggtggaacagctgatcaagggcctggtcgatgcgggctgc
cacgtcagcgacgtcggcctggtgcctaccccggcgctgtactacgcagccaacgtgctg
gccggcaagtccggtgtgatgctgaccggcagccacaacccttcggactacaacggtttc
aagatcgtcatcgccggtgacaccttggccaacgaacagatccaggccctgctgacccgc
ctgaaaaccaacgacctgaccctggcccaaggccgcgtggaaaaggtcgagatcctcgac
cgctacttccagcagatcgtcggcgacgtaaagctggcgaaaaagctcaaggtggtggtg
gactgcggcaacggcgccgccggcgtgattgcaccgcaactgatcgaagccctgggctgc
gaagtgatcccgctgttctgcgaggtcgacggcaacttccccaaccaccacccggacccg
ggcaagccggagaacctcgaagacctgatcgccaaggtcaaggaaaccggtgccgatatc
ggcctggccttcgacggtgacggcgaccgcgtcggcgtggtgaccaacaccggcagcatc
gtctaccccgaccgcctgctgatgctgtttgcccaggacgtgctgtcgcgcaacccgggc
gccgagatcatcttcgacgtcaaatgcacccgccgcctgaccccgctgatcgaacagcac
ggtggcagcgccttgatgtggaaaaccggccattcgctgatcaagaaaaagatgaagcag
accggttcgctgctggcaggcgagatgagcggtcacatcttcatcaaggaacgttggtac
ggttttgacgacggtatctacagcgccgcgcgcctgttggagatcctcagcaagacccag
cagagcgccgaaaacctgtttgccgccttcccgaacgatatttccacgccggaaatcaat
attgatgtgaccgacgagggtaaattcagcatcattgatgcactgcaacgcgacgccgac
tggggcgaagcccacctgaccaccattgacggtgtgcgggtcgactacgccaatggctgg
ggcctggttcgcgcctccaacaccaccccggtgctggtgctgcgcttcgaggccgacagc
gacgccgagttgcaacgtatcaaggatgttttccgcacccagttgctgcgggtagagcct
gagctgcaactgccgttctga

DBGET integrated database retrieval system