KEGG   Pseudomonas putida F1: Pput_5197Help
Entry
Pput_5197         CDS       T00537                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ppf  Pseudomonas putida F1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pput_5197
   00030 Pentose phosphate pathway
    Pput_5197
   00051 Fructose and mannose metabolism
    Pput_5197
   00052 Galactose metabolism
    Pput_5197
   00500 Starch and sucrose metabolism
    Pput_5197
   00520 Amino sugar and nucleotide sugar metabolism
    Pput_5197
  Nucleotide metabolism
   00230 Purine metabolism
    Pput_5197
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pput_5197
Enzymes [BR:ppf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Pput_5197
    5.4.2.8  phosphomannomutase
     Pput_5197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5840458..5841858
Genome map
AA seq 466 aa AA seqDB search
MNDMAHLVPAALPDSIFRAYDIRGVVGKTLHAETAYWIGRAIGAQSLAQGEPQVSVGRDG
RLSGPMLVEQLIKGLVDAGCHVSDVGLVPTPALYYAANVLAGKSGVMLTGSHNPSDYNGF
KIVIAGDTLANEQIQALLTRLKTNDLTLAQGRVEKVEILDRYFQQIVGDVKLAKKLKVVV
DCGNGAAGVIAPQLIEALGCEVIPLFCEVDGNFPNHHPDPGKPENLEDLIAKVKETGADI
GLAFDGDGDRVGVVTNTGSIVYPDRLLMLFAQDVLSRNPGAEIIFDVKCTRRLTPLIEQH
GGSALMWKTGHSLIKKKMKQTGSLLAGEMSGHIFIKERWYGFDDGIYSAARLLEILSKTQ
QSAENLFAAFPNDISTPEINIDVTDEGKFSIIDALQRDADWGEAHLTTIDGVRVDYANGW
GLVRASNTTPVLVLRFEADSDAELQRIKDVFRTQLLRVEPELQLPF
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacatggcccacctggtccccgccgcattgcccgacagcattttccgcgcatat
gacatacgcggcgtggtcggcaagacccttcacgccgaaaccgcctactggatcggccgc
gccatcggcgcgcaaagcctggcccagggcgaaccgcaggtttcggtagggcgcgatggc
cgcctgtcgggcccgatgctggtggaacagctgatcaagggcctggtcgatgcgggctgc
cacgtcagcgacgtcggcctggtgcctaccccggcgctgtactacgcagccaacgtgctg
gccggcaagtccggtgtgatgctgaccggcagccacaacccttcggactacaacggtttc
aagatcgtcatcgccggtgacaccttggccaacgaacagatccaggccctgctgacccgc
ctgaaaaccaacgacctgaccctggcccaaggccgcgtggaaaaggtcgagatcctcgac
cgctacttccagcagatcgtcggcgacgtaaagctggcgaaaaagctcaaggtggtggtg
gactgcggcaacggcgccgccggcgtgattgcaccgcaactgatcgaagccctgggctgc
gaagtgatcccgctgttctgcgaggtcgacggcaacttccccaaccaccacccggacccg
ggcaagccggagaacctcgaagacctgatcgccaaggtcaaggaaaccggtgccgatatc
ggcctggccttcgacggtgacggcgaccgcgtcggcgtggtgaccaacaccggcagcatc
gtctaccccgaccgcctgctgatgctgtttgcccaggacgtgctgtcgcgcaacccgggc
gccgagatcatcttcgacgtcaaatgcacccgccgcctgaccccgctgatcgaacagcac
ggtggcagcgccttgatgtggaaaaccggccattcgctgatcaagaaaaagatgaagcag
accggttcgctgctggcaggcgagatgagcggtcacatcttcatcaaggaacgttggtac
ggttttgacgacggtatctacagcgccgcgcgcctgttggagatcctcagcaagacccag
cagagcgccgaaaacctgtttgccgccttcccgaacgatatttccacgccggaaatcaat
attgatgtgaccgacgagggtaaattcagcatcattgatgcactgcaacgcgacgccgac
tggggcgaagcccacctgaccaccattgacggtgtgcgggtcgactacgccaatggctgg
ggcctggttcgcgcctccaacaccaccccggtgctggtgctgcgcttcgaggccgacagc
gacgccgagttgcaacgtatcaaggatgttttccgcacccagttgctgcgggtagagcct
gagctgcaactgccgttctga

DBGET integrated database retrieval system