KEGG   Pseudomonas putida F1: Pput_5204Help
Entry
Pput_5204         CDS       T00537                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00230  Purine metabolism
ppf01100  Metabolic pathways
Module
ppf_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Pput_5204
Enzymes [BR:ppf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Pput_5204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 Zeta_toxin RsgA_GTPase AAA_22 ABC_tran cobW MMR_HSR1 AAA_18
Motif
Other DBs
NCBI-ProteinID: ABQ81322
JGI: Pput5204
UniProt: A5WB12
Position
5846709..5847329
Genome map
AA seq 206 aa AA seqDB search
MNHSSGTLYIVSAPSGAGKTSLVTALTKDDQQIRVSVSHTTRAMRPGEQHGVNYHFVVHE
EFKTLIAQGDFLEHAEVFGNFYGTSRSALQHTLDQGYDLILEIDWQGAQQVRKLMPEALS
VFILPPSQEALRHRLDGRGQDSEEIIAGRMKEAVSEMVHYDEYDYVIINDDFDAALADLK
AVFRSNRLLLKKQQQRHAALLKQMIG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacagcagcggcaccctctacatcgtttcggccccctcgggtgccggcaagacc
agcctggtcaccgccctgaccaaagacgaccagcagattcgcgtctcggtctcgcacact
acccgcgccatgcgcccgggcgagcagcacggggtgaactatcacttcgtcgtccacgag
gagttcaagacgctgatcgcgcaaggagactttctggagcatgccgaagtgttcggcaac
ttctacggtacttcgcgcagcgcgctgcagcacaccctggaccaaggctacgacctgatc
ctggaaatcgactggcaaggtgcccagcaggtgcgcaagctgatgccagaggcgctgtcg
gtgttcatcctgcctccaagtcaggaggcgcttcgccaccgcctggacggacgcgggcag
gacagcgaagagatcattgccgggcgcatgaaggaagcggtcagcgagatggtgcactac
gacgagtatgactacgtgatcatcaatgatgatttcgacgcggcgctggcagacttgaaa
gcggtgttccgctcgaatcggctgctgttgaagaagcagcagcagcgtcatgcggcgctg
ctgaagcaaatgatcggctaa

DBGET integrated database retrieval system