KEGG   Pseudomonas putida GB-1: PputGB1_0097Help
Entry
PputGB1_0097      CDS       T00650                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg00260  Glycine, serine and threonine metabolism
ppg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppg01100  Metabolic pathways
ppg01110  Biosynthesis of secondary metabolites
ppg01130  Biosynthesis of antibiotics
ppg01230  Biosynthesis of amino acids
Module
ppg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PputGB1_0097
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PputGB1_0097
Enzymes [BR:ppg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PputGB1_0097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB PEP_mutase ThiG KDGP_aldolase BtpA
Motif
Other DBs
NCBI-ProteinID: ABY96013
JGI: PputGB10097
UniProt: B0KFW2
Position
complement(104350..105159)
Genome map
AA seq 269 aa AA seqDB search
MSRLEQRFAELKAEGRSALVTFVTAGDPGYDASLQILKGLPAAGADVIELGMPFTDPMAD
GVAIQLATLRALEAGQTLAKTLQMVREFRVDNQTTPIVLMGYYNPIHRFGVEPFVAEAKA
AGVDGLIIVDLPPEHDAELATPAQAAGIDFIRLTTPTTDDARLPRVLERSSGFVYYVSVA
GVTGAGSATTEHVTEAIARLRRHTDLPISVGFGIRTPEQAANIARLADGVVVGSALVDKI
AQAKSADQAVNDVLSLCSALAEGVRGARR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtcttgaacaacgcttcgccgaactgaaggccgaaggccgttcggcactggtc
accttcgtcaccgcaggcgacccgggctacgacgcctcgctgcagatcctcaaggggctg
ccggccgctggcgccgacgtgatcgaactgggcatgccgttcaccgacccgatggccgat
ggcgtggccatccagctggccaccctgcgcgccctggaagctggccagaccttggccaag
accctgcagatggtccgcgaattccgtgtggataaccagaccacgccaatcgtgctgatg
ggctactacaacccgatccaccgctttggcgtggaaccgttcgtggctgaagccaaagca
gcgggcgtcgatggcctgatcatcgtcgacctgccgccagagcacgacgccgaactggcc
accccggcccaggccgcaggcatcgacttcatccgcctgaccacgccgaccaccgacgat
gcgcgcctgccgcgggtgctggagcgcagctccgggtttgtctactacgtgtcggtggcc
ggggtgaccggtgccggctcggcgaccaccgagcacgtgaccgaagccattgcccgcctg
cgccggcataccgacctgccgatcagcgttggtttcggcatccgtaccccggagcaggct
gcgaacatcgcccgcctggcggatggtgtagtggtgggctcggcgctggtcgacaagatt
gcccaggccaagagtgccgaccaggcagtgaatgatgtactcagcctgtgctcggcactg
gctgaaggggtgcgcggcgcccgtcgctaa

DBGET integrated database retrieval system