KEGG   Pseudomonas putida GB-1: PputGB1_0144Help
Entry
PputGB1_0144      CDS       T00650                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
ppg  Pseudomonas putida GB-1
Brite
Enzymes [BR:ppg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     PputGB1_0144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
146456..148384
Genome map
AA seq 642 aa AA seqDB search
MTEDAERWKEKYLKSIEQQERLERRWDARLDLLRRGLVRSTLAAEGSDKIVDECMKEMRD
VIRSDNMDAGLAGLIPRLEKAVLDSEQRRETRMNQVSDALTALVGQLQGLPLPSDISRPL
KKLAKKLDGGVAQSRELPPLLGELSGLQGRALSALGKPGEDARPGFLQRLFGSREEETLA
EAEHAPVAEAQPQAAGSIALLPPDDVDALQPLPGPAASCAEVTDAPEAELEVSGPALIES
VETQPASLPQMPQDEAPVAEAAASEPLAEAEPLPTLEETFGEDGPYALPYAVEPPYSQVA
AHIEQTLIGLLDDLSLPERHKAQALEMRERVARGLNWYELIPVLDDLAVLMLAITDSGQH
EFETYLQQLNERLEGFQSHLHEASAGHADNSSAARELDSQLREHVDGLQSSVQGAADVDS
LKHILENRLEGLLVTMDEHKHERDRREQELAGRLQGLSERVANMEHEALGYREHLEEQRQ
KALLDPLTGLPNRAAWSERVEREMLDWQENGGHLAMAILDLDHFKRINDSYGHLAGDKVL
KIVADQLRKRLRGRDFIARFGGEEFVLLLPQTPPAAAAQVAELLRATVEACPFHFKGERV
VITTSIGLGAFRPGERSDQVLKRADAALYRAKEHGRNRVEQG
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagacgcagagcgctggaaagaaaaatacctgaaaagcatcgagcagcaagaa
aggctcgaacgccgttgggatgcccgtcttgacttgctgcgtcgcggcctggtgcgtagc
accctggctgccgaaggcagtgacaagatcgtcgatgagtgcatgaaggaaatgcgcgat
gtcatccgcagcgacaatatggacgccggccttgccgggttgattccgcgccttgaaaaa
gcggtgttggactccgaacagcgtcgcgaaacccgcatgaaccaagtcagcgatgcgctg
accgcactggttggccaactgcaaggcttaccgctgcccagcgatatctcgcggccattg
aaaaaactggcgaagaagctcgacggcggggttgcccagtcacgcgagctgccgccgctg
ctgggcgagttgagcggcctgcaggggcgcgcgctgtcggccttgggcaaacccggcgaa
gacgcccggccaggttttctgcagcgtttgttcggcagccgcgaagaagaaacactggcg
gaggcagagcatgcgccggtggccgaagcccagccccaggcagcgggcagcatcgcactc
ttgccgcccgatgacgtcgatgcgctacaaccgttgccgggccctgctgcctcctgcgcc
gaagtgactgacgcacccgaggctgagctggaagtttctggcccggcgctgatcgagtcg
gtcgaaacgcagcccgcctcgttgccacagatgccacaggatgaagcaccagtggcagaa
gctgccgccagcgagccgttggctgaggcagagccgctaccgacactggaagaaaccttc
ggcgaagacggcccctatgccctgccctacgcggtggagccgccttacagccaggttgcc
gcgcacatcgagcaaaccttgatcggcctgctcgatgacctcagcctgcccgagcggcac
aaggcccaggcgttggaaatgcgcgagcgggttgcccgcggcttgaactggtatgagctg
atcccggtgctggatgatctggcggtactcatgctggcgattaccgacagcggccagcac
gaatttgaaacctacctgcagcagctcaacgaacgcctggaaggtttccagagccacttg
catgaagccagcgccggccatgcagacaacagcagtgcggcccgcgagctggatagccaa
ctgcgcgagcacgtcgatggcctgcagagcagcgtgcaaggcgccgccgacgtagacagc
ctcaagcacatcctggaaaaccgcctggaaggcttgctggtgaccatggacgagcacaag
catgagcgtgatcgccgtgagcaagagctggctggccgtctgcaaggcctgtcggagcgg
gtggcgaacatggagcacgaggcgcttggctatcgcgagcatctggaggagcagcgccag
aaagccctgctcgacccgctcactggcctgcccaaccgtgccgcctggagcgagcgagtc
gaacgcgaaatgctcgactggcaagaaaacggtggccatctggcgatggcaattctcgac
cttgaccatttcaaacgcatcaatgacagctatgggcacctggctggagacaaggtcctc
aagatcgttgccgaccagttgcgcaagcgcctgcgtggtcgtgatttcatcgcccgtttt
ggcggcgaagagttcgtcttgctgctaccgcagaccccgccggcggccgccgcacaggtg
gccgagctgctgcgtgccaccgtcgaggcctgcccatttcacttcaagggtgaacgggtg
gtgatcactacctccatcggtctgggcgcattccgtcctggcgagcgcagcgaccaagtg
ctcaagcgcgccgatgccgcgttgtaccgggccaaggagcatgggcgcaatcgcgtcgaa
caaggttag

DBGET integrated database retrieval system