KEGG   Pseudomonas putida GB-1: PputGB1_0144Help
Entry
PputGB1_0144      CDS       T00650                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
ppg  Pseudomonas putida GB-1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
146456..148384
Genome map
AA seq 642 aa AA seqDB search
MTEDAERWKEKYLKSIEQQERLERRWDARLDLLRRGLVRSTLAAEGSDKIVDECMKEMRD
VIRSDNMDAGLAGLIPRLEKAVLDSEQRRETRMNQVSDALTALVGQLQGLPLPSDISRPL
KKLAKKLDGGVAQSRELPPLLGELSGLQGRALSALGKPGEDARPGFLQRLFGSREEETLA
EAEHAPVAEAQPQAAGSIALLPPDDVDALQPLPGPAASCAEVTDAPEAELEVSGPALIES
VETQPASLPQMPQDEAPVAEAAASEPLAEAEPLPTLEETFGEDGPYALPYAVEPPYSQVA
AHIEQTLIGLLDDLSLPERHKAQALEMRERVARGLNWYELIPVLDDLAVLMLAITDSGQH
EFETYLQQLNERLEGFQSHLHEASAGHADNSSAARELDSQLREHVDGLQSSVQGAADVDS
LKHILENRLEGLLVTMDEHKHERDRREQELAGRLQGLSERVANMEHEALGYREHLEEQRQ
KALLDPLTGLPNRAAWSERVEREMLDWQENGGHLAMAILDLDHFKRINDSYGHLAGDKVL
KIVADQLRKRLRGRDFIARFGGEEFVLLLPQTPPAAAAQVAELLRATVEACPFHFKGERV
VITTSIGLGAFRPGERSDQVLKRADAALYRAKEHGRNRVEQG
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagacgcagagcgctggaaagaaaaatacctgaaaagcatcgagcagcaagaa
aggctcgaacgccgttgggatgcccgtcttgacttgctgcgtcgcggcctggtgcgtagc
accctggctgccgaaggcagtgacaagatcgtcgatgagtgcatgaaggaaatgcgcgat
gtcatccgcagcgacaatatggacgccggccttgccgggttgattccgcgccttgaaaaa
gcggtgttggactccgaacagcgtcgcgaaacccgcatgaaccaagtcagcgatgcgctg
accgcactggttggccaactgcaaggcttaccgctgcccagcgatatctcgcggccattg
aaaaaactggcgaagaagctcgacggcggggttgcccagtcacgcgagctgccgccgctg
ctgggcgagttgagcggcctgcaggggcgcgcgctgtcggccttgggcaaacccggcgaa
gacgcccggccaggttttctgcagcgtttgttcggcagccgcgaagaagaaacactggcg
gaggcagagcatgcgccggtggccgaagcccagccccaggcagcgggcagcatcgcactc
ttgccgcccgatgacgtcgatgcgctacaaccgttgccgggccctgctgcctcctgcgcc
gaagtgactgacgcacccgaggctgagctggaagtttctggcccggcgctgatcgagtcg
gtcgaaacgcagcccgcctcgttgccacagatgccacaggatgaagcaccagtggcagaa
gctgccgccagcgagccgttggctgaggcagagccgctaccgacactggaagaaaccttc
ggcgaagacggcccctatgccctgccctacgcggtggagccgccttacagccaggttgcc
gcgcacatcgagcaaaccttgatcggcctgctcgatgacctcagcctgcccgagcggcac
aaggcccaggcgttggaaatgcgcgagcgggttgcccgcggcttgaactggtatgagctg
atcccggtgctggatgatctggcggtactcatgctggcgattaccgacagcggccagcac
gaatttgaaacctacctgcagcagctcaacgaacgcctggaaggtttccagagccacttg
catgaagccagcgccggccatgcagacaacagcagtgcggcccgcgagctggatagccaa
ctgcgcgagcacgtcgatggcctgcagagcagcgtgcaaggcgccgccgacgtagacagc
ctcaagcacatcctggaaaaccgcctggaaggcttgctggtgaccatggacgagcacaag
catgagcgtgatcgccgtgagcaagagctggctggccgtctgcaaggcctgtcggagcgg
gtggcgaacatggagcacgaggcgcttggctatcgcgagcatctggaggagcagcgccag
aaagccctgctcgacccgctcactggcctgcccaaccgtgccgcctggagcgagcgagtc
gaacgcgaaatgctcgactggcaagaaaacggtggccatctggcgatggcaattctcgac
cttgaccatttcaaacgcatcaatgacagctatgggcacctggctggagacaaggtcctc
aagatcgttgccgaccagttgcgcaagcgcctgcgtggtcgtgatttcatcgcccgtttt
ggcggcgaagagttcgtcttgctgctaccgcagaccccgccggcggccgccgcacaggtg
gccgagctgctgcgtgccaccgtcgaggcctgcccatttcacttcaagggtgaacgggtg
gtgatcactacctccatcggtctgggcgcattccgtcctggcgagcgcagcgaccaagtg
ctcaagcgcgccgatgccgcgttgtaccgggccaaggagcatgggcgcaatcgcgtcgaa
caaggttag

DBGET integrated database retrieval system