KEGG   Pseudomonas putida GB-1: PputGB1_0212Help
Entry
PputGB1_0212      CDS       T00650                                 

Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg00860  Porphyrin and chlorophyll metabolism
ppg01100  Metabolic pathways
ppg01110  Biosynthesis of secondary metabolites
ppg01120  Microbial metabolism in diverse environments
Module
ppg_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PputGB1_0212
Enzymes [BR:ppg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PputGB1_0212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ABY96125
JGI: PputGB10212
UniProt: B0KH06
Position
248884..249651
Genome map
AA seq 255 aa AA seqDB search
MSQWRLLLTRPAEDCAALAQSLAEEGVGSSCLPLLAIEPVTLETPQRLLLEGLHGFQAII
VVSKPAARLLLEQLAKASLQPPRQGWFTVGEATAAVLQGAGLEVSAPPRGDDSEALLALP
ALRQAVAAPAPRVLIVRGVGGRELLAERLAEQGASVEYLELYRRCLPVYPAGTLMRRIEA
ERLNGLVVSSGQGFEHLQQLAGADWPQLARLPLFVPSPRVAEQARAAGAQQVVDCRGASA
TALLAAVQRSAAPAS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgagccaatggcgcctgttgctgacccggcctgccgaggactgcgcggcactggcgcaa
agcctggcggaggagggcgtgggcagcagttgcctgccactgctggcgattgagcccgtt
acgttagagaccccgcagcgattgttactggaaggcctgcacggcttccaggcaatcatc
gtggttagcaagccggccgcccgcctgttgcttgagcaactggccaaggccagccttcag
ccgccacgccaaggctggttcacggtgggcgaggcaaccgctgcggtgctgcagggggcg
gggttggaggtgagcgctccgccgcgtggcgatgacagcgaagccttgctggcgctgccg
gccctgcgccaggcagttgccgcgccggcaccgcgtgtgttgatcgttcgcggcgtcgga
ggtcgcgaactgctggcagagcgtcttgcagagcaaggtgctagtgtcgaatatctggaa
ctgtatcgtcgctgcctgccggtatacccggcgggtacgctgatgcgccgcatcgaagcg
gaacgcctcaatggcctggtggtcagcagtgggcagggttttgaacatttgcagcagctg
gccggtgcggattggccgcagctggcacgcctgccgctgttcgtgcccagcccacgggtc
gccgagcaggccagggccgccggggcccaacaggttgtggattgccgtggcgccagtgcc
acggccttgctggcagccgtgcagcgtagcgctgcacctgcctcttaa

DBGET integrated database retrieval system