KEGG   Pseudomonas putida GB-1: PputGB1_0238Help
Entry
PputGB1_0238      CDS       T00650                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K14268  
5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
ppg  Pseudomonas putida GB-1
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PputGB1_0238
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PputGB1_0238
   00310 Lysine degradation
    PputGB1_0238
Enzymes [BR:ppg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PputGB1_0238
    2.6.1.48  5-aminovalerate transaminase
     PputGB1_0238
Amino acid related enzymes [BR:ppg01007]
 Aminotransferase (transaminase)
  Class III
   PputGB1_0238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
277484..278761
Genome map
AA seq 425 aa AA seqDB search
MSKTNESLMQRRVAAVPRGVGQIHPIFVDTAKNSTVIDVEGRELIDFAGGIAVLNTGHLH
PKVVAAVQEQLTKVSHTCFQVLAYEPYVELCEKINKLVPGDFDKKTLLVTTGSEAVENAV
KIARAATGRAGVIAFTGGYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALFPSELHGIS
VDDAIASVERIFKNDAEPRDIAAIILEPVQGEGGFLPAPKELMKRLRALCDQHGILLIAD
EVQTGAGRTGTFFAMEQMGVAPDLTTFAKSIAGGFPLAGVCGKAEYMDAIAPGGLGGTYA
GSPIACAAALAVIEVFEEEKLLDRSKAVGERLTTGLREIQKKHPIIGDVRGLGSMIAVEV
FEKGTHTPNAAAVGQVVAKAREKGLILLSCGTYGNVLRILVPLTAEDALLDKGLAIIEEC
FAELA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaccaacgaatccttgatgcaacgtcgtgtagctgccgtcccacgtggcgtt
ggccagatccacccgatcttcgtcgacaccgcgaagaactcgactgtgatcgacgttgaa
ggccgcgaactgatcgacttcgccggcggcatcgcagtgctgaacaccggccacctgcac
ccgaaagtggttgcggccgtgcaagagcaactgaccaaggtcagccacacctgcttccag
gtactggcttacgaaccttacgtagagctgtgcgaaaagatcaacaagctggtcccaggc
gacttcgacaagaagaccctgctggtcaccaccggctccgaagccgttgaaaacgccgtg
aagatcgcccgtgccgccaccggccgcgctggcgtcatcgccttcaccggcggctaccac
ggccgtaccatgatgaccctgggcctgaccggcaaggttgtgccgtactccgctggcatg
ggcctgatgccaggcggtatcttccgcgccctgttcccgagcgaactgcacggtatcagc
gttgacgacgccatcgcttcggtcgagcgcatcttcaagaacgacgccgagccacgcgac
atcgccgcgatcatcctcgagccagtacaaggcgaaggcggcttcctgccagcgcctaaa
gagctgatgaagcgcctgcgcgccctgtgcgaccagcacggcatcctgctgatcgccgac
gaagtacagactggcgctggccgtaccggcaccttcttcgccatggaacagatgggcgtt
gcgcctgacctgaccaccttcgccaaatccatcgctggcggcttcccgctggccggtgtg
tgcggcaaggccgagtacatggacgcgatcgctccgggcggcctgggcggcacctacgcc
ggttcgccgatcgcttgcgccgcggccctggccgtgatcgaagtgttcgaagaagaaaaa
ctgctggaccgcagcaaggctgtgggtgagcgcctgaccaccggcctgcgcgaaatccag
aagaagcacccgatcatcggcgacgtccgtggtctgggctcgatgatcgctgttgaagtc
ttcgagaaaggcactcacaccccgaacgctgctgctgttggccaggtggttgccaaggca
cgcgaaaagggtctgatcctgctgtcctgcggcacctacggcaacgttctgcgtatcctg
gtaccgctgactgccgaagacgcactgctggacaaaggtctggccatcatcgaagagtgc
ttcgctgaactcgcttga

DBGET integrated database retrieval system