KEGG   Pseudomonas putida GB-1: PputGB1_0424Help
Entry
PputGB1_0424      CDS       T00650                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ppg  Pseudomonas putida GB-1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ppg00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
495727..496236
Genome map
AA seq 169 aa AA seqDB search
MSLSTVYLGLGSNIDREAHLCAGLDALAGILTDMHCSPAFESQAVGIKSGPFINFVVTGK
TALPLIELDRRLKFIEADNGRYAPDRKGLPLDIDVLMYDDLHGTFDGLVLPRAEILKNAF
VLWPLSLLAPELVHPAAGKGMAQLWQEAQIDQVLAPVAFEWRGLQLTPI
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgagcacggtttacctggggctcggcagcaacatcgaccgtgaagcgcatttg
tgcgccgggctcgatgcgttggccggtatcctgacggacatgcattgctcgccggcgttc
gaaagccaggcggtggggatcaagagcgggccgttcatcaacttcgtggtgaccggcaaa
accgcgttgccgttgatcgagctggaccgtcgactgaagttcatcgaggccgacaacggc
cgctatgccccggaccgcaaaggcttgccactggatatcgacgtgctgatgtatgacgat
ttgcacggtactttcgacgggctggtgctgcctcgcgccgagatcttgaaaaacgctttt
gtgttgtggccgctgtcgctgctggcccccgaactggtacatccggcggcgggcaagggc
atggcgcagttatggcaggaggcgcagatcgatcaggtgctggccccggtagccttcgag
tggcgcgggttgcagctgacgcctatctaa

DBGET integrated database retrieval system