KEGG   Pseudomonas putida GB-1: PputGB1_0452Help
Entry
PputGB1_0452      CDS       T00650                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ppg  Pseudomonas putida GB-1
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppg01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ppg00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
528916..529749
Genome map
AA seq 277 aa AA seqDB search
MSVPTVLERIIARKFQEVAERSARVSLAELEALAKAADAPRGFANALIEQAKRKQPAVIA
EIKKASPSKGVIREHFVPAEIAVSYEKGGATCLSVLTDVDYFQGADVYLQQARAAVSLPV
IRKDFMVDPYQIVEARALGADCVLLIVSALDDVKMAELAATAKDVGLDVLVEVHDGDELE
RALKTLDTPLVGVNNRNLHTFEVSLETTLDLLPRIPRDRLAITESGILNRADVELMAINE
VYSFLVGEAFMRAEQPGLELQRLFFPEQVKKTVQPLD
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgccgacagtgctggaaaggatcattgcccgcaagtttcaggaagtggccgag
cgcagcgcacgcgtcagccttgccgagctggaggccctggccaaggccgccgatgctccg
cgtggctttgccaacgcgctgatcgagcaggccaagcgcaagcagccggcggtgattgct
gaaatcaagaaggcctcgccgagcaaaggcgtgatccgcgagcactttgtgccggcggaa
atcgcggtcagctacgagaagggtggcgctacctgcctgtcggtgctgaccgatgtcgat
tacttccagggtgccgatgtgtacctgcagcaggctcgcgcagcagtttccttgccggta
atccgcaaggacttcatggtcgacccttaccagatcgtcgaagcccgggccttgggcgcg
gactgcgtgctactgatcgtgtcggcgctggacgacgtaaagatggccgaactggccgcc
actgccaaggatgtcggccttgatgtgctagtggaagtgcatgatggcgatgagctggag
cgcgccttgaaaaccctcgacacgccgctggttggggtgaacaaccgtaacctgcacacc
tttgaggtgagcctggaaaccaccctcgacctgctgccgcgcattccgcgtgatcgcttg
gcgattaccgagagcggtattctcaaccgagcggacgtggaactgatggcgatcaacgag
gtttactcgttcctggtcggcgaagcgttcatgcgtgccgaacagccaggcctggaactg
caacggttgttcttcccagaacaggtgaagaaaactgtacagccattggactga

DBGET integrated database retrieval system