KEGG   Pseudomonas putida GB-1: PputGB1_0598Help
Entry
PputGB1_0598      CDS       T00650                                 

Definition
(GenBank) alpha/beta hydrolase fold
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg00010  Glycolysis / Gluconeogenesis
ppg00020  Citrate cycle (TCA cycle)
ppg00620  Pyruvate metabolism
ppg01100  Metabolic pathways
ppg01110  Biosynthesis of secondary metabolites
ppg01120  Microbial metabolism in diverse environments
ppg01130  Biosynthesis of antibiotics
ppg01200  Carbon metabolism
Module
ppg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PputGB1_0598
   00020 Citrate cycle (TCA cycle)
    PputGB1_0598
   00620 Pyruvate metabolism
    PputGB1_0598
Enzymes [BR:ppg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PputGB1_0598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Biotin_lipoyl Hydrolase_4 Thioesterase Abhydrolase_3 Ndr Esterase Ser_hydrolase HlyD_3 Abhydrolase_5 GCV_H Esterase_phd PGAP1 Lipase_3
Motif
Other DBs
NCBI-ProteinID: ABY96509
JGI: PputGB10598
UniProt: B0KLA5
Position
complement(675718..676824)
Genome map
AA seq 368 aa AA seqDB search
MSQIHTLTMPKWGLSMTEGRVDAWLKQEGDEINKGDEVLDVETDKISSSVEAPFSGVLRR
QVARPDETLPVGALLAVVVEGEAEEAEIDALVQRFQAEFVAEGGADQAQGPAPQKAEVGG
RLLRWFELGEGGTPLVLVHGFGGDLNNWLFNHPALAAERRVIALDLPGHGESAKALQRGD
LDELSETVLALLDHLDIAKAHLAGHSMGGAVSLNVARLAPQRVASLSLVASAGLGDAING
QYLQGFVSAANRNALKPQMVQLFADPALVTRQMLEDMLKFKRLEGVDDALRQLASALADG
DRQRHDLRGVLGQHPALVVWGGKDAIIPASHAEGLEAEVLVLPEAGHMVQMEAAEQVNQQ
LLAFLRKH
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagccagatccataccctgaccatgcccaagtggggcttgtcgatgaccgagggccgg
gtggacgcctggctcaagcaggaaggtgacgaaatcaacaagggcgacgaggtgctggac
gtcgagaccgacaagatcagcagcagcgtcgaagccccgttcagtggtgtactgcgccgc
caggtggccaggccggatgaaaccctgccggtcggcgcgctactggcagtggtggtggaa
ggcgaagccgaagaagcagaaatcgatgcgctggtgcaacgcttccaggccgagttcgtc
gccgaagggggcgccgatcaggcacaagggccggccccgcagaaggcggaagtcggtggc
cgcctgctgcgctggttcgagctgggcgaaggcggcacgccgctggtgctggtgcacggt
tttggcggcgacctcaacaactggctgttcaaccacccggcgctggccgccgaacgccgc
gtaatcgccctggacctgccggggcacggcgagtcggccaaggccctgcaacggggtgac
ctggacgagctgagcgaaaccgtgctggccttgctcgaccacctggacatcgccaaggcc
cacctggcgggccattccatgggcggtgcggtaagcctcaacgtggcgcgcctggcgccg
cagcgggtggccagcctgagcctggtggccagtgccgggctgggtgacgcaatcaacggg
cagtacctgcaaggttttgtcagcgccgccaaccgcaatgcgcttaaaccacagatggtg
cagctgtttgccgacccggcgctggtcacccggcaaatgcttgaggacatgctcaagttc
aagcgcctggaaggtgttgatgatgccttgcgccagctggcatcggccctcgccgacggc
gaccggcagcgccacgacctgcgcggggtgttgggacagcacccggcactggtggtgtgg
ggcggcaaggacgcgatcatcccggccagccatgccgaaggcctggaggcagaagtactg
gtgctgccggaggctgggcatatggtgcagatggaagcggctgaacaggtcaaccagcaa
ctgctcgcgttcctgcgcaagcactaa

DBGET integrated database retrieval system