KEGG   Pseudomonas putida GB-1: PputGB1_0767Help
Entry
PputGB1_0767      CDS       T00650                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg00900  Terpenoid backbone biosynthesis
ppg01100  Metabolic pathways
ppg01110  Biosynthesis of secondary metabolites
ppg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PputGB1_0767
Enzymes [BR:ppg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PputGB1_0767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABY96677
JGI: PputGB10767
UniProt: B0KND7
Position
complement(876097..876957)
Genome map
AA seq 286 aa AA seqDB search
MHTLTLPAPAKLNLWLHIIGRRADGYHELETVFQFLDHGDELSFALREDGVIRLHTEIEA
VPHDSNLIVRAARKLQEQSGTALGADIWLTKVLPMGGGIGGGSSDAATTLLALAHLWQLD
WDEDRLAALGLSLGADVPVFVRGHAAFAQGVGEQLTPVDPIEPWYVVLVPQVSVSTVEIF
SHPQLTRDSLPLKMRPVPEGNSRNDCQPVVEQNYPEVRNALNSLGKFTEARLTGTGSCVF
GAFPSKAEADKVLALLSATQTGFVAKGSNISMLHRKLQSLVKKSSA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcacacgctcaccctgcccgccccggccaagctcaacctgtggttgcacatcatcggc
cgccgcgccgacggttaccacgagctggaaacggtgttccagttcctcgaccacggcgac
gaactgagcttcgccctgcgtgaagacggcgtgatccgcctgcacaccgagatcgaggcc
gtcccccacgacagcaacctgatcgtgcgcgccgcgcgcaagctgcaagaacaatcaggc
accgcactcggtgccgatatctggctgaccaaggtgctgcccatgggcggcggcatcggc
ggcggcagctcggatgccgccaccaccctgctggccctcgcccacctgtggcaactggat
tgggacgaagaccgcctggccgcactgggcctgagcctgggcgccgacgtgccggtgttc
gtacgcggccatgcggcgttcgcccaaggtgtgggcgagcaactgacaccggtcgacccg
atcgagccctggtatgtcgtactggtgccgcaagtgtctgtcagcacagtagaaattttt
tcacatccacagttgacacgtgattcactcccccttaagatgcgccccgttcccgaggga
aacagtcgaaatgactgccaaccggtggtagagcagaattacccagaagttcgcaatgcg
ttgaattcactggggaaattcactgaggctcggctaaccggcactggaagttgtgtgttt
ggggccttcccaagcaaagccgaagctgataaagttctggcccttctttcagcgacccaa
acagggtttgtggcgaaaggaagcaatatttcgatgttgcatcgcaagctgcaaagtctg
gtcaagaagtcgagcgcataa

DBGET integrated database retrieval system