KEGG   Pseudomonas putida GB-1: PputGB1_0973Help
Entry
PputGB1_0973      CDS       T00650                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg00340  Histidine metabolism
ppg01100  Metabolic pathways
ppg01110  Biosynthesis of secondary metabolites
ppg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    PputGB1_0973
Enzymes [BR:ppg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PputGB1_0973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABY96883
JGI: PputGB10973
UniProt: B0KQJ5
Position
1108134..1109459
Genome map
AA seq 441 aa AA seqDB search
MTVSTAIARLNAADPDFARHLDHLLSWESVSDDAVNQRVLDIIKAVRERGDAALVEFTQR
FDGVDAKSIEDLILNRERLELALTRITPIQREALEKAANRVRMYHERQKQDSWQYTEADG
TVLGQKVTPLDRAGLYVPGGKASYPSSVLMNAIPAKVAGVAEVVMVVPTPRGEVNELVLA
AACIAGVDRVFTVGGAQAVAALAYGTESVPQVDKIVGPGNIYVATAKRHVFGQVGIDMIA
GPSEILVVCDGQTDPDWIAMDLFSQAEHDEDAQAILVSPDAAFLDRVAASIDKLMPTMER
AEIIEKSINGRGALIQVRDMQQAMDVANRIAPEHLELSVADPQAWLPHIRHAGAIFMGRH
TSEALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSIIFCSEQGASELGHTASVLARG
ESLTAHARSAEYRILTQDKGN
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgtccactgcaattgcccgtctcaacgctgctgatccggatttcgcccgacat
ctggatcatctgctgagctgggaaagtgtgtctgatgacgcggtcaaccagcgcgtgctc
gacatcatcaaggccgtgcgtgagcgtggcgatgccgcgctggtggaattcacccagcgt
ttcgatggtgtcgatgcgaagtcgattgaagacctgatcctcaaccgcgaacgcctggaa
ctggcgctgacccgcattacccctatccagcgcgaagccctggaaaaggccgccaaccgt
gtgcgcatgtaccacgaacggcagaagcaggactcctggcagtacaccgaagccgacggc
accgtgctcggccagaaagtcaccccactggaccgtgctggcctgtacgtgccaggcggc
aaggcgtcgtacccgtcgtcggtgctgatgaacgccatcccggccaaggttgccggcgtg
gccgaagtggtgatggtagtgccgaccccgcgtggtgaggtcaacgaactggtgctggcc
gccgcgtgcatcgccggtgtcgaccgtgtgttcaccgtcgggggggctcaggctgtcgct
gcgctggcctacggtaccgaaagcgtgccgcaggtcgacaagatcgtcggccctggcaac
atctacgttgccaccgccaagcgccacgtgttcggccaggtaggcatcgacatgatcgcc
ggcccgtcagaaatcctcgtggtctgcgacggccagaccgacccggactggatcgccatg
gacctgttctcccaggccgaacacgacgaagacgcccaggccattctggttagcccggat
gccgccttcctcgaccgcgttgccgccagcatcgacaagctgatgccgaccatggagcgt
gccgagatcatcgagaagtcgatcaatggccgtggcgcgctgatccaggtgcgtgacatg
cagcaggccatggatgtggccaaccgcatcgccccggagcacctggagttgtctgtggcc
gacccgcaggcctggctgccgcacattcgccacgctggcgcgatcttcatgggccgccac
accagcgaagcgctgggcgactactgcgccggccccaaccacgtgctgcccacctccggc
accgcgcgcttctcgtcgccgctgggggtgtatgacttccagaagcgttcgtcgatcatc
ttctgctccgagcagggtgcatccgaattgggccacaccgcctcggtcctggcccgtggc
gagtcgctgaccgcccacgcccgtagcgccgaataccgtatcctgacccaagacaagggg
aactga

DBGET integrated database retrieval system