KEGG   Pseudomonas putida GB-1: PputGB1_1010Help
Entry
PputGB1_1010      CDS       T00650                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ppg  Pseudomonas putida GB-1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PputGB1_1010 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PputGB1_1010 (glk)
   00052 Galactose metabolism
    PputGB1_1010 (glk)
   00500 Starch and sucrose metabolism
    PputGB1_1010 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PputGB1_1010 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PputGB1_1010 (glk)
   00524 Butirosin and neomycin biosynthesis
    PputGB1_1010 (glk)
Enzymes [BR:ppg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PputGB1_1010 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1151630..1152592
Genome map
AA seq 320 aa AA seqDB search
MKDLLVGDIGGTNARFALWRDNQLHDVKVFATADYTSPEQAIEAYLEGQGIARGGLAAVC
LAVAGPVDGDEFRFTNNHWRLSRTAFCKTLQVDQLLLINDFTAMALGMTRLREGEFREVC
PGQADPSRPALVIGPGTGLGVGSLLRLGEQHWQALPGEGGHVDLPVGNAREAAIHQHIHG
QIGHVSAETVLSGGGLVRLYQAICALDGDTPRHKTPAQVTDAALGGEPRALAVVEQFCRF
LGRVAGNNVLTLGARGGVYIVGGVIPRFAELFLRSGFAASFADKGCMSGYFAGVPVWLVT
AEFSGLLGAGVALQQALDHS
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacctgctggttggcgacatcggcggcaccaatgcccgttttgcgttgtggcgt
gacaaccagctgcatgatgtgaaggttttcgccactgcagactacaccagcccggagcag
gccattgaggcttacctcgaaggccagggcatcgcccgcggtggattggcggcggtatgc
ctggcggtagctgggccggtcgatggcgacgaattccgcttcaccaacaaccattggcgt
ctgagccgcaccgccttctgcaagaccttgcaggtcgatcagctgttgctgatcaacgat
ttcactgccatggcgctgggcatgactcgcctgcgcgaaggggagttccgcgaagtgtgc
cccggccaggccgacccttcgcggccggcgctggtgatcgggccagggacaggcctgggg
gtgggctcgctgctgcgccttggtgagcagcactggcaagccctgccaggtgaaggcggg
catgttgacctgccggtgggcaatgcccgcgaagcggcgatccaccaacacatccatggg
cagattggccatgtcagcgccgagaccgtgctcagtgggggtggcctggtgcggttgtac
caggcgatctgcgcactggacggcgacacccccaggcacaagaccccggcgcaggtcacc
gatgccgcactgggcggcgagcctcgagcgctggcggtggtcgagcagttctgccggttt
cttgggcgcgtggcgggtaacaatgtgctgacgctgggcgcgcgaggtggggtctatatc
gtcggcggcgtgattccgcgcttcgccgagttgttcctgcgtagcgggtttgccgccagt
tttgccgacaagggttgtatgagtggttattttgctggcgtgccggtgtggctggtgacg
gccgagttttccgggttgctgggagccggggtggccttgcagcaggctttggatcatagc
tag

DBGET integrated database retrieval system