KEGG   Pseudomonas putida GB-1: PputGB1_1010Help
Entry
PputGB1_1010      CDS       T00650                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg00010  Glycolysis / Gluconeogenesis
ppg00052  Galactose metabolism
ppg00500  Starch and sucrose metabolism
ppg00520  Amino sugar and nucleotide sugar metabolism
ppg00521  Streptomycin biosynthesis
ppg01100  Metabolic pathways
ppg01110  Biosynthesis of secondary metabolites
ppg01120  Microbial metabolism in diverse environments
ppg01130  Biosynthesis of antibiotics
ppg01200  Carbon metabolism
Module
ppg_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PputGB1_1010
   00052 Galactose metabolism
    PputGB1_1010
   00500 Starch and sucrose metabolism
    PputGB1_1010
   00520 Amino sugar and nucleotide sugar metabolism
    PputGB1_1010
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PputGB1_1010
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PputGB1_1010
Enzymes [BR:ppg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PputGB1_1010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK Pan_kinase
Motif
Other DBs
NCBI-ProteinID: ABY96920
JGI: PputGB11010
UniProt: B0KRC6
Position
1151630..1152592
Genome map
AA seq 320 aa AA seqDB search
MKDLLVGDIGGTNARFALWRDNQLHDVKVFATADYTSPEQAIEAYLEGQGIARGGLAAVC
LAVAGPVDGDEFRFTNNHWRLSRTAFCKTLQVDQLLLINDFTAMALGMTRLREGEFREVC
PGQADPSRPALVIGPGTGLGVGSLLRLGEQHWQALPGEGGHVDLPVGNAREAAIHQHIHG
QIGHVSAETVLSGGGLVRLYQAICALDGDTPRHKTPAQVTDAALGGEPRALAVVEQFCRF
LGRVAGNNVLTLGARGGVYIVGGVIPRFAELFLRSGFAASFADKGCMSGYFAGVPVWLVT
AEFSGLLGAGVALQQALDHS
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacctgctggttggcgacatcggcggcaccaatgcccgttttgcgttgtggcgt
gacaaccagctgcatgatgtgaaggttttcgccactgcagactacaccagcccggagcag
gccattgaggcttacctcgaaggccagggcatcgcccgcggtggattggcggcggtatgc
ctggcggtagctgggccggtcgatggcgacgaattccgcttcaccaacaaccattggcgt
ctgagccgcaccgccttctgcaagaccttgcaggtcgatcagctgttgctgatcaacgat
ttcactgccatggcgctgggcatgactcgcctgcgcgaaggggagttccgcgaagtgtgc
cccggccaggccgacccttcgcggccggcgctggtgatcgggccagggacaggcctgggg
gtgggctcgctgctgcgccttggtgagcagcactggcaagccctgccaggtgaaggcggg
catgttgacctgccggtgggcaatgcccgcgaagcggcgatccaccaacacatccatggg
cagattggccatgtcagcgccgagaccgtgctcagtgggggtggcctggtgcggttgtac
caggcgatctgcgcactggacggcgacacccccaggcacaagaccccggcgcaggtcacc
gatgccgcactgggcggcgagcctcgagcgctggcggtggtcgagcagttctgccggttt
cttgggcgcgtggcgggtaacaatgtgctgacgctgggcgcgcgaggtggggtctatatc
gtcggcggcgtgattccgcgcttcgccgagttgttcctgcgtagcgggtttgccgccagt
tttgccgacaagggttgtatgagtggttattttgctggcgtgccggtgtggctggtgacg
gccgagttttccgggttgctgggagccggggtggccttgcagcaggctttggatcatagc
tag

DBGET integrated database retrieval system