KEGG   Pseudomonas putida GB-1: PputGB1_1284Help
Entry
PputGB1_1284      CDS       T00650                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ppg  Pseudomonas putida GB-1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ppg00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ppg00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1431437..1431988
Genome map
AA seq 183 aa AA seqDB search
MRAHWLTVPVLALLASTSSWAADCPALLQGSLPELRGKGQVELCERFAGKPLVVVNTASY
CGFAPQFEGLEATYKEYHGQGLEMLGVPSNDFKQEDADSEKTAKVCYANYGVTFTMTKTQ
AVRGKDAIPLFAELASQSSAPKWNFYKYVVDRKGKVIGNFSSLTKPDDPAFRAAIEKAIA
SQP
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcacattggttgacggtgccggtgctggccctgcttgccagcacatcaagctgg
gctgccgattgcccggcattgttgcagggtagcctgccagagttgcgcggcaaggggcag
gtcgagctgtgcgagcgctttgccggcaagccgctggtggtggtgaacaccgccagctat
tgcggttttgccccgcaattcgaggggcttgaggcgacgtacaaggaatatcacgggcag
ggcctggaaatgctgggcgtgccgtccaatgacttcaagcaggaagacgccgatagcgaa
aagaccgccaaggtttgctatgccaactatggcgttaccttcaccatgaccaagacgcaa
gctgtgcggggcaaggatgcgataccgctgtttgcggagctggccagccagagcagtgcg
ccgaagtggaatttctacaagtatgttgtcgatcgtaaggggaaggtgattggtaacttc
tccagcctgaccaaaccggatgatcctgcgttccgtgcagccatcgaaaaggccatcgct
tcacagccgtag

DBGET integrated database retrieval system