KEGG   Pseudomonas putida GB-1: PputGB1_1284Help
Entry
PputGB1_1284      CDS       T00650                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ppg  Pseudomonas putida GB-1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PputGB1_1284
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PputGB1_1284
Enzymes [BR:ppg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PputGB1_1284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1431437..1431988
Genome map
AA seq 183 aa AA seqDB search
MRAHWLTVPVLALLASTSSWAADCPALLQGSLPELRGKGQVELCERFAGKPLVVVNTASY
CGFAPQFEGLEATYKEYHGQGLEMLGVPSNDFKQEDADSEKTAKVCYANYGVTFTMTKTQ
AVRGKDAIPLFAELASQSSAPKWNFYKYVVDRKGKVIGNFSSLTKPDDPAFRAAIEKAIA
SQP
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcacattggttgacggtgccggtgctggccctgcttgccagcacatcaagctgg
gctgccgattgcccggcattgttgcagggtagcctgccagagttgcgcggcaaggggcag
gtcgagctgtgcgagcgctttgccggcaagccgctggtggtggtgaacaccgccagctat
tgcggttttgccccgcaattcgaggggcttgaggcgacgtacaaggaatatcacgggcag
ggcctggaaatgctgggcgtgccgtccaatgacttcaagcaggaagacgccgatagcgaa
aagaccgccaaggtttgctatgccaactatggcgttaccttcaccatgaccaagacgcaa
gctgtgcggggcaaggatgcgataccgctgtttgcggagctggccagccagagcagtgcg
ccgaagtggaatttctacaagtatgttgtcgatcgtaaggggaaggtgattggtaacttc
tccagcctgaccaaaccggatgatcctgcgttccgtgcagccatcgaaaaggccatcgct
tcacagccgtag

DBGET integrated database retrieval system