KEGG   Pseudomonas putida GB-1: PputGB1_1410Help
Entry
PputGB1_1410      CDS       T00650                                 

Definition
oxidase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ppg  Pseudomonas putida GB-1
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PputGB1_1410
Enzymes [BR:ppg01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     PputGB1_1410
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     PputGB1_1410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1581568..1582104
Genome map
AA seq 178 aa AA seqDB search
MSILSVFHPDSPALPNKVLTHHDDIAATLAEHGVRFAHAEHGLRVRPGTAQDEVLGACRV
YLDQLMTGHGSKAFVLLNRDGEDPVQVDVRDEHVHDADEVFAVVGGRAQVGLRLGGWVYS
VLCEKGDQLVIPAGTRRWVELGDTPFCLALRLYGSEQGVQARFTGDVAARAFLGIDEL
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgagtattctcagcgttttccaccccgacagcccggcactgccgaacaaggtgctgact
caccacgatgacatcgctgccacattggccgagcacggagtgcgctttgcccatgccgag
catggcctgcgggtgcgccccggtacggcccaggatgaggtgctgggcgcttgccgtgta
tacctggaccagttgatgacggggcatggcagcaaggcgttcgtgctgttgaaccgtgac
ggtgaggacccggtacaggtcgatgtgcgcgatgagcatgtgcatgacgccgacgaggtg
tttgccgtggtcggagggcgtgcgcaggtgggcctgcggttgggcggctgggtgtattcg
gtgctgtgcgagaaaggtgaccagcttgtgataccggcggggacgcgccgctgggttgag
ctgggcgacacgccgttttgcctggcgttgcgcttgtacggcagcgagcagggcgtgcag
gcgcggttcaccggggatgtggctgcacgggcgtttttggggattgacgaactgtag

DBGET integrated database retrieval system