KEGG   Pseudomonas putida GB-1: PputGB1_1569Help
Entry
PputGB1_1569      CDS       T00650                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg00051  Fructose and mannose metabolism
ppg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PputGB1_1569
Enzymes [BR:ppg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     PputGB1_1569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ABY97474
JGI: PputGB11569
UniProt: B0KG53
Position
complement(1767837..1768619)
Genome map
AA seq 260 aa AA seqDB search
MTTTMHTPKDQLVKLAQQQMLTALADNTYTARQKLALTCRILFDGGHDSGLAGQITARAQ
EPGTYYTQQLGLGFDEIAASNLLVVDEDLTVLQGRGMANPANRFHSWLYRARPDVNCIIH
THPLHSAALSMLEVPLAISHMDLCPLFDDCAFLKEWPGVPVGNEEGEIIAKAIGDKRAIL
LSHHGLLIAGGSIEEACVLALLFERAAKMQLLAMGAGDIRPIPEALGKEAHDWISTPKRH
GAAFSYYARRALRAHGDCLG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccaccatgcacacccccaaggaccagttggtcaaactcgcccagcagcagatg
ctgacggcgctggccgacaatacctacaccgcccggcaaaaacttgccctcacctgccgc
atcctcttcgacggcggccacgactctggcctggccggacagatcaccgcgcgcgcccag
gaacctggcacttattacacccaacaactgggcctgggcttcgacgaaattgccgcctcc
aacctgctggtggtggacgaagacctcaccgtgctgcaaggccgtggcatggccaacccg
gccaaccgcttccacagttggctgtaccgcgcccgccccgacgtcaactgcatcatccac
acccacccgctgcacagcgcggccctgtcgatgctggaagtgccgctggccatctcgcac
atggacctgtgcccgttgttcgacgactgcgcattcctcaaggagtggcccggcgtgccg
gtgggcaacgaagaaggcgaaatcatcgcgaaggcgattggcgataagcgcgcgatcctg
ctttctcaccacggtttgctgattgccggtggttcgatcgaagaagcctgcgtgctcgcc
ctgctgttcgagcgcgcggcaaagatgcaactgctggccatgggcgccggtgacatccgc
cccatccccgaagcactgggcaaagaagcccacgactggatctccacccccaaacgtcat
ggtgccgcgttcagctactacgcgcgccgtgccttgcgtgcccatggcgactgcctgggc
tga

DBGET integrated database retrieval system