KEGG   Pseudomonas putida GB-1: PputGB1_1569Help
Entry
PputGB1_1569      CDS       T00650                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ppg  Pseudomonas putida GB-1
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PputGB1_1569
Enzymes [BR:ppg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     PputGB1_1569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1767837..1768619)
Genome map
AA seq 260 aa AA seqDB search
MTTTMHTPKDQLVKLAQQQMLTALADNTYTARQKLALTCRILFDGGHDSGLAGQITARAQ
EPGTYYTQQLGLGFDEIAASNLLVVDEDLTVLQGRGMANPANRFHSWLYRARPDVNCIIH
THPLHSAALSMLEVPLAISHMDLCPLFDDCAFLKEWPGVPVGNEEGEIIAKAIGDKRAIL
LSHHGLLIAGGSIEEACVLALLFERAAKMQLLAMGAGDIRPIPEALGKEAHDWISTPKRH
GAAFSYYARRALRAHGDCLG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccaccatgcacacccccaaggaccagttggtcaaactcgcccagcagcagatg
ctgacggcgctggccgacaatacctacaccgcccggcaaaaacttgccctcacctgccgc
atcctcttcgacggcggccacgactctggcctggccggacagatcaccgcgcgcgcccag
gaacctggcacttattacacccaacaactgggcctgggcttcgacgaaattgccgcctcc
aacctgctggtggtggacgaagacctcaccgtgctgcaaggccgtggcatggccaacccg
gccaaccgcttccacagttggctgtaccgcgcccgccccgacgtcaactgcatcatccac
acccacccgctgcacagcgcggccctgtcgatgctggaagtgccgctggccatctcgcac
atggacctgtgcccgttgttcgacgactgcgcattcctcaaggagtggcccggcgtgccg
gtgggcaacgaagaaggcgaaatcatcgcgaaggcgattggcgataagcgcgcgatcctg
ctttctcaccacggtttgctgattgccggtggttcgatcgaagaagcctgcgtgctcgcc
ctgctgttcgagcgcgcggcaaagatgcaactgctggccatgggcgccggtgacatccgc
cccatccccgaagcactgggcaaagaagcccacgactggatctccacccccaaacgtcat
ggtgccgcgttcagctactacgcgcgccgtgccttgcgtgcccatggcgactgcctgggc
tga

DBGET integrated database retrieval system