KEGG   Pseudomonas putida GB-1: PputGB1_1676Help
Entry
PputGB1_1676      CDS       T00650                                 

Definition
(GenBank) fatty oxidation complex, alpha subunit FadB
  KO
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ppg  Pseudomonas putida GB-1
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PputGB1_1676
   01212 Fatty acid metabolism
    PputGB1_1676
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PputGB1_1676
   00650 Butanoate metabolism
    PputGB1_1676
  Lipid metabolism
   00071 Fatty acid degradation
    PputGB1_1676
   01040 Biosynthesis of unsaturated fatty acids
    PputGB1_1676
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PputGB1_1676
   00310 Lysine degradation
    PputGB1_1676
   00380 Tryptophan metabolism
    PputGB1_1676
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PputGB1_1676
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PputGB1_1676
   00281 Geraniol degradation
    PputGB1_1676
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PputGB1_1676
   00930 Caprolactam degradation
    PputGB1_1676
Enzymes [BR:ppg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PputGB1_1676
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PputGB1_1676
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PputGB1_1676
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     PputGB1_1676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1897562..1899709
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAITVKALESGIVELKFDLKGESVNKFNRLTLNELRQAVEAIQADASVKGVIVSS
GKDVFIVGADITEFVDNFKLPEAELVAGNLEANRIFNAFEDLEVPTVAAINGIALGGGLE
MCLAADYRVMSNSAKIGLPEVKLGIYPGFGGTVRLPRLIGSDNAIEWIAAGKENRAEDAL
KVGAVDAVVAPELLLAGALDLIKRAISGELDYKAKRQPKLEKLKLNAIEQMMAFETAKGF
VAGQAGPNYPAPVEAIKSIQKAANFGRDKALEVEAAGFAKLAKTSVAESLIGLFLNDQEL
KRKAKAHDEIAHDVKQAAVLGAGIMGGGIAYQSAVKGTPILMKDIREEAIQLGLNEASKL
LGNRVEKGRLTPAKMAEALNAIRPTLSYGDFANVDIVVEAVVENPKVKQAVLAEVEGQVK
DDAILASNTSTISINLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSEVAVATTVA
YAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKVMEKFGWPMGPAYL
MDVVGIDTGHHGRDVMAEGFPDRMKDERRSAVDALYEANRLGQKNGKGFYAYETDKRGKP
KKVFDATVLDVLKPIVFEQREVTDEDIINWMMVPLCLETVRCLEDGIVETAAEADMGLVY
GIGFPPFRGGALRYIDSIGVAEFVALADQYADLGPLYHPTAKLREMAKNGQRFFN
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaggctcttgaaagtggcatcgtcgagctc
aagttcgacctcaagggtgagtccgtcaacaagttcaaccgcctgaccctgaacgagctg
cgccaggccgtcgaagccatccaggccgacgcctcggtcaagggcgtgatcgtcagcagt
ggcaaggacgtgttcatcgtcggcgccgacatcaccgagttcgtcgacaacttcaagctg
cccgaggccgaactggtcgccggcaacctggaagccaaccgcatcttcaacgcctttgaa
gacctcgaagtgcccaccgttgccgccatcaacggcatcgccctgggcggcggcctggaa
atgtgcctggcagccgactaccgggtcatgtccaacagcgccaagatcggcctgccagaa
gtcaagctgggtatctaccctggcttcggcggcaccgtgcgtctgccacgccttatcggc
tcggacaacgccatcgagtggatcgccgccggcaaggaaaaccgtgccgaggacgccctg
aaagtgggtgccgttgacgccgtggtcgcccctgagctgctgctggccggtgctctcgac
ctgatcaagcgcgccatcagtggcgagctggattacaaggccaagcgccagccaaagctg
gagaaactcaagctcaacgccatcgagcagatgatggccttcgagaccgccaagggcttt
gtcgccggccaggccgggccgaactacccagccccggtcgaagccatcaagtccattcag
aaagccgccaacttcggtcgcgacaaagcgctggaagtcgaagccgcaggctttgccaag
ctggccaagacttcggtcgccgagagcctgatcggcctgttcctcaacgaccaggagctc
aagcgcaaggccaaggcgcatgacgaaatcgcccatgacgtgaagcaggccgccgtgctc
ggcgccggcatcatgggtggcggcattgcctaccagtcggcggtcaagggcaccccgatc
ctgatgaaggacatccgcgaggaagccatccagctgggcctgaacgaggcctccaagctg
ctcggcaaccgcgtcgagaagggccgcctgaccccggccaagatggccgaggcactcaac
gccattcgcccgaccctgtcctatggcgatttcgccaatgtcgacatcgtcgtcgaggcc
gtggtcgagaacccgaaggtcaagcaagcggtactggcggaagtggaaggccaggtgaag
gacgatgcgatcctcgcctccaacacttcgaccatttccatcaacctgctggccaaggcg
ctcaagcgcccggaaaacttcgtcggcatgcacttcttcaacccggtgcacatgatgccg
ctggtggaagtgattcgtggcgagaagtccagtgaagtggcggttgccaccaccgtggcc
tacgccaagaaaatgggcaagaacccgatcgtggtcaacgactgcccgggctttttggtc
aaccgcgtgctgttcccttacttcggcggcttcgccaagctggtcagtgccggtgtcgac
ttcgtgcgcatcgacaaggtaatggaaaagttcggctggccgatgggcccggcctacctg
atggacgtggtcggtatcgacaccggccaccatggtcgcgacgtaatggccgaaggtttc
ccggaccgcatgaaggacgagcgccgctcggccgtcgatgcgctgtacgaggccaaccgc
ctgggccagaagaatggtaaaggcttctacgcctacgaaaccgacaagcgcggcaagccg
aagaaggtcttcgacgccaccgtgctcgatgtgctcaagccgatcgtgttcgagcagcgt
gaagtcaccgacgaagacatcatcaactggatgatggtcccgctgtgcctggagaccgtg
cgctgcctggaagacggcatcgtcgaaaccgctgccgaagccgatatgggcctggtctac
ggcattggtttccctcccttccgcggtggtgcgctgcgttacatcgactcgatcggtgtt
gccgaattcgtcgccctggccgatcagtatgccgatctggggccgctgtaccacccgacc
gccaagctgcgtgaaatggccaagaacggccagcgcttcttcaactga

DBGET integrated database retrieval system