KEGG   Pseudomonas putida GB-1: PputGB1_1686Help
Entry
PputGB1_1686      CDS       T00650                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ppg  Pseudomonas putida GB-1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PputGB1_1686
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    PputGB1_1686
Enzymes [BR:ppg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PputGB1_1686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1907495..1908505
Genome map
AA seq 336 aa AA seqDB search
MTVSLQGSLMVDIAGKWLTAEDRHLLRQPEVAGLIIFARNIDSPRQVRELCASIRAIRPE
LILAVDQEGGRVQRLRQGFVRLPSMRALADNDNADYLAEQCGWLMATEVLAVGLDLSFAP
VLDLDHQRSAVVGSRAFEGDPLRATQLAGAFIRGMNAAGMAACGKHFPGHGWAEADSHVA
IPTDERSLEQLRQADLVPFTRLSGQLAAVMPAHVIYPQVDNQPAGFSRRWLQDILRGELG
FDGVIFSDDLSMAGAHVVGDAASRIEAALSAGCDMGLVCNDRAAAELALSAAQRMKVKPS
PRIARMRGQGFARTDYRQQPRWLEALGALKDAQLVD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcagcctgcaaggctccctgatggtggatatcgccggtaaatggctgaccgcc
gaagaccgtcacctgttgcgtcagcccgaagtggctggcctgatcatctttgcccgcaac
atcgacagcccgcgtcaggtgcgcgagttgtgcgcgtcgatccgcgctattcgccccgag
ctgatcctggcggtggaccaggaaggtggccgcgtacagcgcctgcgccagggctttgtg
cggctgccatccatgcgcgcgctggccgacaatgacaatgccgattacctggcagagcag
tgtggctggctaatggcgaccgaggtattggcggttggcctggacctcagttttgcccct
gtgctcgacctggatcaccagcgtagtgccgtggttggcagccgagctttcgagggtgac
ccgctgcgtgccacgcaactggccggggcgttcattcgtggtatgaatgcggccggcatg
gcggcctgtggcaagcacttccctgggcacggctgggccgaggcggactcgcatgtggcg
attcctaccgatgagcgcagcctggagcaactgcgccaggccgacctggtgccgttcacc
cgcctgagcgggcagttggcggcagtgatgccggcgcatgtcatctacccgcaggtcgat
aaccagccagctggcttctcgcggcgttggctgcaggacatcctgcgtggtgagctgggc
tttgacggggtgattttcagcgatgatctgtcgatggccggtgcgcatgtggtgggggac
gcggccagtcgtatcgaggcggcgttaagcgccggctgtgacatgggcctggtatgcaat
gaccgggcggcggcagagctggcgctgagtgcggcacagcgcatgaaggtcaagccgtcg
ccgcggattgcgcgcatgcgcgggcaagggtttgcgcggaccgattaccgtcagcagccg
cgctggctggaggcattgggtgcgctgaaggacgctcagctggtcgattga

DBGET integrated database retrieval system