KEGG   Pseudomonas putida GB-1: PputGB1_1839Help
Entry
PputGB1_1839      CDS       T00650                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ppg  Pseudomonas putida GB-1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PputGB1_1839
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PputGB1_1839
   00620 Pyruvate metabolism
    PputGB1_1839
   00640 Propanoate metabolism
    PputGB1_1839
  Energy metabolism
   00680 Methane metabolism
    PputGB1_1839
Enzymes [BR:ppg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PputGB1_1839
Lipid biosynthesis proteins [BR:ppg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PputGB1_1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2069358..2071004
Genome map
AA seq 548 aa AA seqDB search
MRDYAEAARAFDLAQAATAALHGNLEALNACVECCDRHAGGGKLALIHEDRDGHTERYSF
EQLKVQAARFANVLKAQGVSAGDRVAGLMPRTPELLVTILATWRLGAVYQPLFTAFGPKA
IEHRLEQSHARVVVTDSQNRAKLDDVHACPTIITVKARVGELDFQQCLERAADDCEPVMR
AGNDPFLLMFTSGTTGPAKPLEVPLRAIVAFQGYMRDAIDLRPEDNFWNLADPGWAYGLY
YAVTGPLSLGHATTFYDGPFSVESCARVIDKLGITNLAGSPTAYRLLIAAGSAFSAPVKG
RLRVVSSAGEPLNPEVIRWFADELGVTIHDHYGQTELGMVLCNHHGLQHPVHLGSAGFAI
PGHRIVVLDEQGSELPAGQPGILAVDREQSPLCWFGGYHGLPTKSFVGKYYLSGDTVELN
QDGSISFVGRSDDVITTSGYRVGPFDVESALIEHPAVIEAAVIGKPDPERTELIKAFVVL
ASGVAGNAELEETLRQHVRQRLYAHAYPREIEFVSELPKTPSGKLQRFILRNQEVAKQHA
QQATPVSA
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgattacgccgaggccgctcgagcgttcgaccttgcgcaggccgctactgcggca
ctgcatggcaacctcgaagccctcaatgcctgtgtcgaatgctgcgaccgccatgccggt
ggcggcaagctggcgctgatccacgaagaccgggacggccacactgagcggtacagtttc
gagcaactcaaggtgcaggctgcccgttttgccaatgtactcaaggcgcaaggcgtgagt
gccggggaccgggtggcgggtctaatgccccgtacacctgagttgcttgtcaccatcctc
gccacctggcgcctgggggcggtgtatcagccgttgttcactgcgttcggccccaaggcc
atcgagcatcgccttgagcagtcgcacgcccgtgtcgtcgtcaccgacagccaaaaccgt
gccaagctggacgacgtgcatgcctgcccgacgatcatcacggtcaaggctcgcgttggc
gagctggatttccaacagtgccttgagcgtgcggcagacgactgtgaaccggtcatgcgc
gcgggtaacgacccgttcttgctcatgttcacttcaggcacgactggcccggccaagcca
ctggaagtgcctctgcgtgccatcgtcgcgtttcaaggctacatgcgcgacgccatcgac
ctgcgccccgaagacaacttctggaacctggccgacccggggtgggcctatggcctgtac
tacgcggtcaccggcccgttgtcgctgggccatgccaccacgttctacgatggcccgttc
agcgtcgaaagctgcgcgcgagtcatcgacaagcttggcatcaccaacctggcaggctcg
cccaccgcgtaccgcctgttgatcgccgccggcagtgctttttcggcgcccgtcaaaggc
cgcctgcgggtagtcagcagtgccggtgagccgcttaacccggaagtgatccgctggttt
gccgacgagcttggggtcaccatccacgaccattacggccagaccgaactgggcatggtg
ctgtgcaaccaccatggcctgcagcacccggtgcatctgggctcggccggcttcgccatc
cccggtcatcgcattgtcgtgctggacgagcagggtagcgaactacctgccggccagccg
ggcatccttgcggtcgatcgcgagcagtcgccgctgtgctggttcggtggttaccacggt
ttgccgaccaaatcgttcgtcggcaagtactacctcagtggcgacaccgtcgagctgaac
caggatggcagcatcagtttcgtcggccgtagcgacgatgtgatcactacctccggctac
cgggtcggcccattcgatgtggagagtgcgttgatcgagcacccggcggtgatcgaggcg
gccgtgatcggcaaaccggacccggagcgcaccgagctgatcaaggccttcgtggtcttg
gccagcggcgtcgccggcaacgccgagctggaagaaaccttgcgccagcacgtgcgccag
cgcctatacgcgcatgcctaccccagagaaatcgaattcgtcagcgagctgcccaagacc
ccgagcggcaagctgcaacgcttcatcctgcgtaatcaggaagtcgccaaacaacacgcg
caacaggccacccctgtcagcgcctga

DBGET integrated database retrieval system