KEGG   Pseudomonas putida GB-1: PputGB1_1839Help
Entry
PputGB1_1839      CDS       T00650                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg00010  Glycolysis / Gluconeogenesis
ppg00620  Pyruvate metabolism
ppg00640  Propanoate metabolism
ppg00680  Methane metabolism
ppg01100  Metabolic pathways
ppg01110  Biosynthesis of secondary metabolites
ppg01120  Microbial metabolism in diverse environments
ppg01130  Biosynthesis of antibiotics
ppg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PputGB1_1839
   00620 Pyruvate metabolism
    PputGB1_1839
   00640 Propanoate metabolism
    PputGB1_1839
  Energy metabolism
   00680 Methane metabolism
    PputGB1_1839
Enzymes [BR:ppg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PputGB1_1839
Lipid biosynthesis proteins [BR:ppg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PputGB1_1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABY97742
JGI: PputGB11839
UniProt: B0KIG6
Position
2069358..2071004
Genome map
AA seq 548 aa AA seqDB search
MRDYAEAARAFDLAQAATAALHGNLEALNACVECCDRHAGGGKLALIHEDRDGHTERYSF
EQLKVQAARFANVLKAQGVSAGDRVAGLMPRTPELLVTILATWRLGAVYQPLFTAFGPKA
IEHRLEQSHARVVVTDSQNRAKLDDVHACPTIITVKARVGELDFQQCLERAADDCEPVMR
AGNDPFLLMFTSGTTGPAKPLEVPLRAIVAFQGYMRDAIDLRPEDNFWNLADPGWAYGLY
YAVTGPLSLGHATTFYDGPFSVESCARVIDKLGITNLAGSPTAYRLLIAAGSAFSAPVKG
RLRVVSSAGEPLNPEVIRWFADELGVTIHDHYGQTELGMVLCNHHGLQHPVHLGSAGFAI
PGHRIVVLDEQGSELPAGQPGILAVDREQSPLCWFGGYHGLPTKSFVGKYYLSGDTVELN
QDGSISFVGRSDDVITTSGYRVGPFDVESALIEHPAVIEAAVIGKPDPERTELIKAFVVL
ASGVAGNAELEETLRQHVRQRLYAHAYPREIEFVSELPKTPSGKLQRFILRNQEVAKQHA
QQATPVSA
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgattacgccgaggccgctcgagcgttcgaccttgcgcaggccgctactgcggca
ctgcatggcaacctcgaagccctcaatgcctgtgtcgaatgctgcgaccgccatgccggt
ggcggcaagctggcgctgatccacgaagaccgggacggccacactgagcggtacagtttc
gagcaactcaaggtgcaggctgcccgttttgccaatgtactcaaggcgcaaggcgtgagt
gccggggaccgggtggcgggtctaatgccccgtacacctgagttgcttgtcaccatcctc
gccacctggcgcctgggggcggtgtatcagccgttgttcactgcgttcggccccaaggcc
atcgagcatcgccttgagcagtcgcacgcccgtgtcgtcgtcaccgacagccaaaaccgt
gccaagctggacgacgtgcatgcctgcccgacgatcatcacggtcaaggctcgcgttggc
gagctggatttccaacagtgccttgagcgtgcggcagacgactgtgaaccggtcatgcgc
gcgggtaacgacccgttcttgctcatgttcacttcaggcacgactggcccggccaagcca
ctggaagtgcctctgcgtgccatcgtcgcgtttcaaggctacatgcgcgacgccatcgac
ctgcgccccgaagacaacttctggaacctggccgacccggggtgggcctatggcctgtac
tacgcggtcaccggcccgttgtcgctgggccatgccaccacgttctacgatggcccgttc
agcgtcgaaagctgcgcgcgagtcatcgacaagcttggcatcaccaacctggcaggctcg
cccaccgcgtaccgcctgttgatcgccgccggcagtgctttttcggcgcccgtcaaaggc
cgcctgcgggtagtcagcagtgccggtgagccgcttaacccggaagtgatccgctggttt
gccgacgagcttggggtcaccatccacgaccattacggccagaccgaactgggcatggtg
ctgtgcaaccaccatggcctgcagcacccggtgcatctgggctcggccggcttcgccatc
cccggtcatcgcattgtcgtgctggacgagcagggtagcgaactacctgccggccagccg
ggcatccttgcggtcgatcgcgagcagtcgccgctgtgctggttcggtggttaccacggt
ttgccgaccaaatcgttcgtcggcaagtactacctcagtggcgacaccgtcgagctgaac
caggatggcagcatcagtttcgtcggccgtagcgacgatgtgatcactacctccggctac
cgggtcggcccattcgatgtggagagtgcgttgatcgagcacccggcggtgatcgaggcg
gccgtgatcggcaaaccggacccggagcgcaccgagctgatcaaggccttcgtggtcttg
gccagcggcgtcgccggcaacgccgagctggaagaaaccttgcgccagcacgtgcgccag
cgcctatacgcgcatgcctaccccagagaaatcgaattcgtcagcgagctgcccaagacc
ccgagcggcaagctgcaacgcttcatcctgcgtaatcaggaagtcgccaaacaacacgcg
caacaggccacccctgtcagcgcctga

DBGET integrated database retrieval system