KEGG   Pseudomonas putida GB-1: PputGB1_1843Help
Entry
PputGB1_1843      CDS       T00650                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg00071  Fatty acid degradation
ppg00280  Valine, leucine and isoleucine degradation
ppg00281  Geraniol degradation
ppg00310  Lysine degradation
ppg00360  Phenylalanine metabolism
ppg00362  Benzoate degradation
ppg00380  Tryptophan metabolism
ppg00410  beta-Alanine metabolism
ppg00627  Aminobenzoate degradation
ppg00640  Propanoate metabolism
ppg00650  Butanoate metabolism
ppg00903  Limonene and pinene degradation
ppg00930  Caprolactam degradation
ppg01100  Metabolic pathways
ppg01110  Biosynthesis of secondary metabolites
ppg01120  Microbial metabolism in diverse environments
ppg01130  Biosynthesis of antibiotics
ppg01212  Fatty acid metabolism
Module
ppg_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PputGB1_1843
   00650 Butanoate metabolism
    PputGB1_1843
  Lipid metabolism
   00071 Fatty acid degradation
    PputGB1_1843
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PputGB1_1843
   00310 Lysine degradation
    PputGB1_1843
   00360 Phenylalanine metabolism
    PputGB1_1843
   00380 Tryptophan metabolism
    PputGB1_1843
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PputGB1_1843
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PputGB1_1843
   00281 Geraniol degradation
    PputGB1_1843
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PputGB1_1843
   00627 Aminobenzoate degradation
    PputGB1_1843
   00930 Caprolactam degradation
    PputGB1_1843
Enzymes [BR:ppg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PputGB1_1843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ABY97746
JGI: PputGB11843
UniProt: B0KIH0
Position
2074139..2074912
Genome map
AA seq 257 aa AA seqDB search
MAFETILLDIHGKVGLITLNRPQALNALNAQIVGEINQALDQLERDPNIGCVVLTGSAKA
FAAGADIKEMAELQYPQIYVDDLFSDADRIANRRKPIIAAVSGFALGGGCELAMMCDFIL
AADNAKFGQPEINLGVLPGMGGTQRLTRAVGKAKAMELCLTGRLMGAEEAERAGLVARIV
PQAELLEEALKVAATIASKSIPVSMMVKESVNRAFEVTLSEGVRFERRVFHAAFSTEDQK
EGMAAFIAKREAQFKDR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcattcgaaaccatcctgttggacatccacggcaaggtcggcctgatcaccctcaac
cgcccgcaagccctcaatgcgctgaacgcgcagattgtcggcgagatcaaccaggccctt
gaccagctcgagcgtgacccgaatatcggttgcgtggtgctgacaggttcggccaaggcc
tttgccgctggcgccgacatcaaggaaatggccgaactgcaatacccgcagatctacgtc
gacgacctgttcagcgatgctgaccgcattgccaaccggcgcaagccgatcatcgcggcg
gtctccggcttcgcgctgggcggcggctgcgagttggcgatgatgtgtgactttatcctc
gccgccgacaacgccaagttcggtcaaccggaaatcaaccttggcgtgttgccgggcatg
ggcggtacccagcgtctgacccgtgccgtgggtaaggccaaggccatggaactgtgcctg
actggccgcctgatgggggctgaagaggctgagagggctggcttggtggcgcgaatcgtg
ccgcaggcggagttgctggaagaggcgcttaaggtggctgcgaccattgccagcaaatcg
atcccggtgagcatgatggtcaaggagagcgttaaccgagcgtttgaagttaccctcagc
gagggcgtgcgctttgaacgccgggtcttccatgcggctttctccactgaagaccaaaaa
gaaggcatggccgccttcatcgccaagcgcgaggcgcagttcaaggatcgttga

DBGET integrated database retrieval system