KEGG   Pseudomonas putida GB-1: PputGB1_1843Help
Entry
PputGB1_1843      CDS       T00650                                 

Definition
enoyl-CoA hydratase/isomerase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ppg  Pseudomonas putida GB-1
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PputGB1_1843
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PputGB1_1843
   00650 Butanoate metabolism
    PputGB1_1843
  Lipid metabolism
   00071 Fatty acid degradation
    PputGB1_1843
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PputGB1_1843
   00310 Lysine degradation
    PputGB1_1843
   00360 Phenylalanine metabolism
    PputGB1_1843
   00380 Tryptophan metabolism
    PputGB1_1843
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PputGB1_1843
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PputGB1_1843
   00281 Geraniol degradation
    PputGB1_1843
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PputGB1_1843
   00627 Aminobenzoate degradation
    PputGB1_1843
   00930 Caprolactam degradation
    PputGB1_1843
Enzymes [BR:ppg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PputGB1_1843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2074139..2074912
Genome map
AA seq 257 aa AA seqDB search
MAFETILLDIHGKVGLITLNRPQALNALNAQIVGEINQALDQLERDPNIGCVVLTGSAKA
FAAGADIKEMAELQYPQIYVDDLFSDADRIANRRKPIIAAVSGFALGGGCELAMMCDFIL
AADNAKFGQPEINLGVLPGMGGTQRLTRAVGKAKAMELCLTGRLMGAEEAERAGLVARIV
PQAELLEEALKVAATIASKSIPVSMMVKESVNRAFEVTLSEGVRFERRVFHAAFSTEDQK
EGMAAFIAKREAQFKDR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcattcgaaaccatcctgttggacatccacggcaaggtcggcctgatcaccctcaac
cgcccgcaagccctcaatgcgctgaacgcgcagattgtcggcgagatcaaccaggccctt
gaccagctcgagcgtgacccgaatatcggttgcgtggtgctgacaggttcggccaaggcc
tttgccgctggcgccgacatcaaggaaatggccgaactgcaatacccgcagatctacgtc
gacgacctgttcagcgatgctgaccgcattgccaaccggcgcaagccgatcatcgcggcg
gtctccggcttcgcgctgggcggcggctgcgagttggcgatgatgtgtgactttatcctc
gccgccgacaacgccaagttcggtcaaccggaaatcaaccttggcgtgttgccgggcatg
ggcggtacccagcgtctgacccgtgccgtgggtaaggccaaggccatggaactgtgcctg
actggccgcctgatgggggctgaagaggctgagagggctggcttggtggcgcgaatcgtg
ccgcaggcggagttgctggaagaggcgcttaaggtggctgcgaccattgccagcaaatcg
atcccggtgagcatgatggtcaaggagagcgttaaccgagcgtttgaagttaccctcagc
gagggcgtgcgctttgaacgccgggtcttccatgcggctttctccactgaagaccaaaaa
gaaggcatggccgccttcatcgccaagcgcgaggcgcagttcaaggatcgttga

DBGET integrated database retrieval system