KEGG   Pseudomonas putida GB-1: PputGB1_1920Help
Entry
PputGB1_1920      CDS       T00650                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ppg  Pseudomonas putida GB-1
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PputGB1_1920
Enzymes [BR:ppg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PputGB1_1920
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PputGB1_1920
Lipid biosynthesis proteins [BR:ppg01004]
 Fatty acid synthase
  Component type
   PputGB1_1920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2160743..2161342
Genome map
AA seq 199 aa AA seqDB search
MWWLSAGLALYCLAQSAAAGTLLIVGDSISAGFGLDTRQGWVSLLQTRLKDEGFDDKVVN
ASISGDTSAGGQARLPALLAAHKPSLVVLELGGNDGLRGQPPAQLQQNLASMIERSRQAG
AKVLLLGMRLPPNYGVRYTTAFANVYEQLAADKQVPLVPFFLEGVGGVPELMQADGIHPA
QGAQQRLLENAWPAIKPLL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgtggtggttgagtgccggtctggccctgtattgcctggcccagagcgcggcggcggga
acgctgctgattgttggcgatagtatcagcgccggttttggcctggatacccgccagggt
tgggtgtctctcttgcagacccgcctcaaggacgaaggtttcgatgacaaagtggtcaat
gcatcgatcagcggcgacaccagcgcaggcggccaggcacggctgccggcgctgcttgca
gcccataaacccagcctggtggtgttggagctgggcggtaacgatggcctgcgcgggcag
ccgcccgcgcaattgcaacaaaatcttgcgtcgatgatcgagcgttcgcgccaggctggt
gccaaggtacttttgttgggcatgcgcctaccgcccaattatggtgtgcgctacaccacc
gcatttgccaacgtgtatgaacagctggcagcggacaagcaggtgcccttggtgccgttt
ttccttgaaggggtagggggcgtgcctgagctgatgcaggccgacggcatccatccggcg
cagggtgcccagcagcgcctgctggaaaatgcctggccagcgataaaacccttgctgtga

DBGET integrated database retrieval system