KEGG   Pseudomonas putida GB-1: PputGB1_2218Help
Entry
PputGB1_2218      CDS       T00650                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
ppg  Pseudomonas putida GB-1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ppg00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:ppg02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2475299..2475697)
Genome map
AA seq 132 aa AA seqDB search
MPTLAPHKFAIPFLLATLVSPLALAEDCAAPQRQQGEQVFARDCAACHSAQKGGPAMMGP
NLHDVVGRTPGSVPGANYSQAMKSRQASWTAQAIGAFIEQPQAAVPGTYMPYAGLPDAGE
RQAVTCFLAGLK
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccctcgccccccacaagttcgcaatcccgttcctgctcgccactctggtcagc
ccccttgccctggccgaagactgcgccgcgccacaacgccagcaaggcgaacaggtgttt
gcccgtgactgcgcagcctgccattcggcacaaaagggcggcccggcaatgatgggcccc
aacctgcacgacgtggtaggccgtacacctggcagcgtgccaggcgccaactactcgcag
gccatgaagagccgccaggccagctggacggcgcaagccatcggcgccttcatcgagcaa
ccacaggccgcagtccccggcacctacatgccctacgccgggctgccggatgctggcgaa
cgccaggcggtgacctgcttcctcgccgggctcaaataa

DBGET integrated database retrieval system