KEGG   Pseudomonas putida GB-1: PputGB1_2423Help
Entry
PputGB1_2423      CDS       T00650                                 

Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ppg  Pseudomonas putida GB-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PputGB1_2423
Enzymes [BR:ppg01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PputGB1_2423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2710751..2711773
Genome map
AA seq 340 aa AA seqDB search
MSEPVQFPLAAVVGADDLKLALCLTAIDPKIGGVLIEGPRGMAKSTLARGLADLLGEGPF
VTLPLGASEERLVGTLDLDAALGQGKAQFSPGVLAQADGGVLYVDEVNLLPDTLVDLLLD
VAASGTNRIERDGISHRHNARFVLIGTMNPEEGELRPQLLDRFGLNVALEGLPEPEARQQ
IIRRRLAFDSDPKAFCDQWATAQAQLRERCQAARQALAQIALDDQALAWITERCYAAGVD
GLRADLVWLRAARAHCAWRGAAAIEEVDVEAVAEFALRHRRRVMPQAKTPSAPQPPDQQP
GQPGGGNPGEQGAQGDWGALPAQPVASGARREVPNWAKKP
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacccgtacaatttccgctggcggcggtggtcggtgccgacgacctgaagctg
gcgctgtgcctgaccgccatcgacccgaagatcggcggcgtgctgatcgaagggccgcgt
ggcatggccaagagcaccctggcccgtggcctggctgacctgcttggcgaaggcccgttc
gtgaccttgccattgggcgccagtgaagagcggctggtcggcaccctcgacctggatgcc
gcgctggggcagggcaaggcgcagttttcccctggggtgctggcccaagccgacggtggc
gtgctgtatgtcgatgaggtcaacctgctgccggacacgttggttgacctgttgctcgat
gtggctgccagtggcaccaaccgcatcgagcgcgacggcatctcgcaccggcacaatgcc
cgtttcgtgctgatcggcaccatgaacccggaagagggcgagctgcgcccgcaactgctc
gaccgttttggcctgaacgtggcgctggaaggcttgcccgagcccgaggcccggcagcag
atcattcgccgacgcctggcgttcgacagtgaccccaaggcgttctgtgaccaatgggca
acggcccaggcgcaactgcgtgagcgctgccaggcggcgcgccaggccttggcccagatt
gccctggatgatcaggcgctggcctggattaccgagcgctgctacgccgctggcgtcgac
ggcctgcgcgccgacctggtctggctgcgtgcggcgcgcgcccattgtgcctggcgcggt
gctgcggctattgaagaggtggatgtcgaagcggtggccgagttcgccttgcgtcatcgc
cgccgtgtcatgccccaggccaaaacgccgtcggcgccgcagccgcctgaccagcagccc
ggccaaccgggtggcggcaaccctggtgaacagggtgcgcagggcgactggggggcattg
ccggcgcagccggtggccagcggcgcacgccgcgaggtaccgaactgggcaaaaaagccc
tga

DBGET integrated database retrieval system