KEGG   Pseudomonas putida GB-1: PputGB1_2683Help
Entry
PputGB1_2683      CDS       T00650                                 

Definition
catechol 1,2-dioxygenase
Orthology
K03381  
catechol 1,2-dioxygenase [EC:1.13.11.1]
Organism
ppg  Pseudomonas putida GB-1
Pathway
Chlorocyclohexane and chlorobenzene degradation
Benzoate degradation
Fluorobenzoate degradation
Toluene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol ortho-cleavage, catechol => 3-oxoadipate
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PputGB1_2683
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PputGB1_2683
   00364 Fluorobenzoate degradation
    PputGB1_2683
   00361 Chlorocyclohexane and chlorobenzene degradation
    PputGB1_2683
   00623 Toluene degradation
    PputGB1_2683
Enzymes [BR:ppg01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.1  catechol 1,2-dioxygenase
     PputGB1_2683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3008693..3009607)
Genome map
AA seq 304 aa AA seqDB search
MTVKISQTGEVQQFFAEAAGVGNDAGSPRLKRIVQRVLQDSARLIEDLEISEDEFWHAVD
YLNRLGGRGEAGLLVAGLGLEHFLDLLQDAKDQQAGLVGGTPRTIEGPLYVAGAPIAQGE
VRMDDGSEEGVATVMYLQGQVLDPQGQPLPGATVDLWHANTRGTYSFFDQSQSEYNLRRR
IVTDAEGRYRARSIVPSGYGCDPQGPTQECLDLLGRHGQRPAHVHFFISAPGYRHLTTQI
NLSGDKYLWDDFAYATRDGLVGEVVFVEGEAGRHAELKFDFQLQTALGGADEQRSNRPRA
LQDA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgaaaatttcccaaactggcgaagtacagcagttctttgcagaggccgcaggc
gttggcaacgatgccggcagccctcggctcaagcgcatcgtgcagcgtgtgctgcaggac
tctgcgcggctgatcgaagacctggagatcagcgaggacgagttctggcatgccgtcgac
tacctgaaccgcctgggtggccgcggcgaagccgggctgctggtggcgggcctgggcctc
gagcacttccttgacctgctacaggatgccaaggaccagcaggccgggctggtcggcggc
accccacgcaccatcgaaggcccgctgtacgtggccggtgcaccgattgcccaaggtgaa
gtgcgcatggacgacggtagcgaggagggcgtagccacggtgatgtacctgcaaggccag
gtgctcgacccgcaagggcagccgctgccaggcgccacggtggacttgtggcatgccaat
acccgtggcacctactcgttcttcgaccagagccagtctgaatacaacctgcgtcggcgc
atcgtcaccgatgccgaagggcgttaccgcgcacgctccatcgtgccgtcgggttacgga
tgtgacccgcaggggccaacccaggagtgcctggacctgctgggccgccacggccagcgc
ccggcgcatgtgcacttcttcatctcggcgccgggttaccggcacctgaccacgcagatc
aacctgtcgggggacaagtacctgtgggatgactttgcctatgccacgcgcgatgggctg
gtgggggaagtggtgttcgtcgaaggcgaggcggggcggcatgccgagttgaagttcgac
ttccagctgcagacggccctgggcggcgcggatgagcagcgcagcaaccggccacgggcg
ttgcaggacgcctga

DBGET integrated database retrieval system