KEGG   Pseudomonas putida GB-1: PputGB1_2683Help
Entry
PputGB1_2683      CDS       T00650                                 

Definition
catechol 1,2-dioxygenase
Orthology
K03381  
catechol 1,2-dioxygenase [EC:1.13.11.1]
Organism
ppg  Pseudomonas putida GB-1
Pathway
Chlorocyclohexane and chlorobenzene degradation
Benzoate degradation
Fluorobenzoate degradation
Toluene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol ortho-cleavage, catechol => 3-oxoadipate
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:ppg01220]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:ppg00362]
Metabolism; Xenobiotics biodegradation and metabolism; Fluorobenzoate degradation [PATH:ppg00364]
Metabolism; Xenobiotics biodegradation and metabolism; Chlorocyclohexane and chlorobenzene degradation [PATH:ppg00361]
Metabolism; Xenobiotics biodegradation and metabolism; Toluene degradation [PATH:ppg00623]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3008693..3009607)
Genome map
AA seq 304 aa AA seqDB search
MTVKISQTGEVQQFFAEAAGVGNDAGSPRLKRIVQRVLQDSARLIEDLEISEDEFWHAVD
YLNRLGGRGEAGLLVAGLGLEHFLDLLQDAKDQQAGLVGGTPRTIEGPLYVAGAPIAQGE
VRMDDGSEEGVATVMYLQGQVLDPQGQPLPGATVDLWHANTRGTYSFFDQSQSEYNLRRR
IVTDAEGRYRARSIVPSGYGCDPQGPTQECLDLLGRHGQRPAHVHFFISAPGYRHLTTQI
NLSGDKYLWDDFAYATRDGLVGEVVFVEGEAGRHAELKFDFQLQTALGGADEQRSNRPRA
LQDA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgaaaatttcccaaactggcgaagtacagcagttctttgcagaggccgcaggc
gttggcaacgatgccggcagccctcggctcaagcgcatcgtgcagcgtgtgctgcaggac
tctgcgcggctgatcgaagacctggagatcagcgaggacgagttctggcatgccgtcgac
tacctgaaccgcctgggtggccgcggcgaagccgggctgctggtggcgggcctgggcctc
gagcacttccttgacctgctacaggatgccaaggaccagcaggccgggctggtcggcggc
accccacgcaccatcgaaggcccgctgtacgtggccggtgcaccgattgcccaaggtgaa
gtgcgcatggacgacggtagcgaggagggcgtagccacggtgatgtacctgcaaggccag
gtgctcgacccgcaagggcagccgctgccaggcgccacggtggacttgtggcatgccaat
acccgtggcacctactcgttcttcgaccagagccagtctgaatacaacctgcgtcggcgc
atcgtcaccgatgccgaagggcgttaccgcgcacgctccatcgtgccgtcgggttacgga
tgtgacccgcaggggccaacccaggagtgcctggacctgctgggccgccacggccagcgc
ccggcgcatgtgcacttcttcatctcggcgccgggttaccggcacctgaccacgcagatc
aacctgtcgggggacaagtacctgtgggatgactttgcctatgccacgcgcgatgggctg
gtgggggaagtggtgttcgtcgaaggcgaggcggggcggcatgccgagttgaagttcgac
ttccagctgcagacggccctgggcggcgcggatgagcagcgcagcaaccggccacgggcg
ttgcaggacgcctga

DBGET integrated database retrieval system