KEGG   Pseudomonas putida GB-1: PputGB1_2793Help
Entry
PputGB1_2793      CDS       T00650                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg00072  Synthesis and degradation of ketone bodies
ppg00650  Butanoate metabolism
ppg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PputGB1_2793
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    PputGB1_2793
Enzymes [BR:ppg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     PputGB1_2793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR PALP
Motif
Other DBs
NCBI-ProteinID: ABY98687
JGI: PputGB12793
UniProt: B0KU24
Structure
PDB: 

Jmol
Position
3139914..3140684
Genome map
AA seq 256 aa AA seqDB search
MTLNGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPAPAMAEIARHGVKVVHHPAD
LSDVAQIEALFNLAEGQFGGVDILVNNAGIQHVAPVEQFPTESWDKIIALNLSAVFHGTR
LALPGMRTRNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSKVTCNAI
CPGWVLTPLVQKQIDDRAANGGDPLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGS
QVRGAAWNVDGGWLAQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcaacggcaagactgcactcgtcaccggttccaccagcggcatcggcctgggc
atcgcccaggtgttggcccgcgcgggtgccaacatcgtgctcaacggctttggcgacccg
gcaccggccatggccgagattgcccggcacggggtgaaggtggtccatcacccggcagac
ctgtcggacgtggcccagatcgaggccttgttcaacctggcagaaggccaatttggcggc
gtcgacattctggtcaacaacgccggtattcagcatgtggcgccggtggagcagttcccc
accgaaagctgggacaagatcattgccctgaacctgtcggctgtattccatggcacccgt
ttggcgctgccgggcatgcgcacgcgcaactgggggcggatcatcaacatcgcttcggtg
catggtttggtgggttcgaccggcaaggcagcctacgtggcggccaagcacggtgtagtc
gggctgaccaaggtggtaggcctggaaaccgccaccagcaaggtcacctgcaacgcgatc
tgcccaggttgggtattgaccccgctggtacagaaacagatcgacgatcgtgccgccaac
ggtggcgatccactgcaagcgcaacacgatctattggcagaaaagcaaccgtccttggcc
ttcgttacccccgagcacttgggtgaactggtactattcttgtgcagcgaggccggtagc
caggttcgcggcgccgcctggaacgtcgatggtggctggttggcccagtga

DBGET integrated database retrieval system