KEGG   Pseudomonas putida GB-1: PputGB1_3018Help
Entry
PputGB1_3018      CDS       T00650                                 

Definition
signal transduction histidine kinase with CheB and CheR activity
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
ppg  Pseudomonas putida GB-1
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PputGB1_3018
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PputGB1_3018
Enzymes [BR:ppg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     PputGB1_3018
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PputGB1_3018
Two-component system [BR:ppg02022]
 CheA family
  CheA-CheYBV
   PputGB1_3018
Bacterial motility proteins [BR:ppg02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PputGB1_3018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3361185..3365300
Genome map
AA seq 1371 aa AA seqDB search
MKSSSKTSLASPHNPSLSPSHLDFPVVGIGASAGGLEAVQAFFQHAPENCGMAFVVVLHL
SPDHQSQADRLIQRVTRMPVCQVSEPVPIERDHVYVISPANRLSTNDGYLRVSPARRSRG
DHVAIDLFFRDLADVHKDHAFCVILSGSGSDGAVGLSRIKEQGGVTLVQSPDDAQYPDMP
KAAIATGMVDLILPVTEIPGKLLELWRSAQKVKLPEIEDDSLPPPLGERSGDPAQSDPLL
DDILTRLHAGTGHDFQHYKRATILRRLERRLHVTAQTDLAGYRDYLERHPEECRALLADM
LIGVTNFFRDREAFEALQQHVMPGLAIDDSEDLQREVRIWSAGCSSGEEAYSLAMMATEQ
LAMEQRSAKVQVFATDLDERAINVGRLGVYPDAIATDVPTARLRQFFIKEDQHYRVRKDI
REKVLFARHNLLSDPPFSQLDLVVCRNLLIYLDREVQREILRLFHFALRKGGYLFLGSSE
SADVAADLFIAVDKHHRIFRAREVEPARRPGRLHTPDTQAIRAKPKPKPLRKLSYAEIHH
RALSRRTPPSLIVDGDGNILHMSDGVGRFLRHAGGEVSPSLLNLVLTPLRPALRSSLLQA
HNTGQPVSSGAVITTIDDQRVEIQVQVQPHQDEPSGSECLLVVFQVREADPHSPPAIQQT
EGMVLNTLERELQRTRQQLQETIEQSDISSQELMASNEEMQAINEELRLASEELETSKEE
LQSINEELLTVNYELKTKVDETDKVNDYLSNLIASTQIATVFVDRNLHIRWFTPGATAIF
SILPVDTGRSLLDITHRLEYPGLADDARAVIERETTIEREVIGQDQHWYLARLLPYRASE
QNVDGTVLTFIDITESRAAEERLRQGEERMRLVAESTHDFAIILLDEQGLIIDWNTGAAL
IFGYAKDEVLGLHYALIFTEQDRENGEPERELRAARQHGRGQDERWHVRKDGSRFYCSGE
VSRLKGSSLRGYVKIARDLTGHKRLQDEQSKRLAESQSSSHMKDEFFAVMSHELKHPLNL
IQLNADILRRIPSVTSTGMASKAVNVIREAVTSQARIIDDLLDVARIRTGKLKLKTQPVD
LCAVLQGICAVACNEQRGRSVRLTLPADGEPVLVEADSTRVEQIIWNLLNNALKFSPADG
DILLRLTRQDEQARLEVIDQGIGLAEDSLEGIFELFNQATPTGHGREGLGIGLSLVRQLV
EAHGGAVSVESPGVGQGCTFVITLPLCVYTQQPQVQGEALPSEGRLTGVRILLVDDSLDV
LEVMEQLLLMEDADVDAYSDPKLALQSAADARYDVIISDIGMPGMDGHALIRALRGLEHL
RYIPAIALTGYGASADQHKSRQSGFDRHLNKPVGYDDLIDAIERLNGSASV
NT seq 4116 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgtccagcaagacttccctcgcctcgccgcacaacccttcgctcagccccagc
catctggactttccagtggtgggcatcggggcatcggccggcgggctggaggcggtgcag
gcgtttttccagcacgcccccgaaaactgcggcatggcgttcgtcgtggtgctgcacttg
tcgccggaccaccagagccaggccgatcgcttgatccagcgcgtcacgcgcatgccggtg
tgccaggtaagcgagccagtaccgatcgagcgtgaccacgtttatgtcatttcgccggcc
aaccgcctgtccaccaatgacggttacctgcgggtcagtccggccagacgcagccgcggc
gaccacgtcgccatcgacctgttcttccgcgaccttgctgatgtgcacaaggaccatgcg
ttctgcgtgatcctttcgggcagcggtagcgatggcgcagtgggcctgtcgcgcatcaag
gaacaaggtggcgtgaccctcgtgcagtcgcccgatgacgcccagtaccccgacatgccc
aaggctgccatcgccactggcatggtcgacctgatcctgccggtaaccgagatcccgggc
aagctgttggaactgtggcgctcggcacagaaggtgaaacttccggaaatagaggatgac
agcctgcccccgcctctgggcgaacgttcaggcgacccagcccaatccgacccgctgctc
gacgacatcctcacccgcctgcatgccggtaccggccacgatttccagcactacaagcgc
gcgacgatcctgcgccgacttgaacggcgcctgcatgtcaccgcacagaccgacctggcc
ggttaccgcgattaccttgagcggcatcctgaggaatgccgtgcattgctggctgacatg
ttgataggggtcaccaatttcttccgggaccgcgaagccttcgaagcattgcagcagcat
gtgatgccgggccttgccattgacgacagcgaagatcttcagcgcgaagtgcgcatctgg
tcggcaggttgttcatccggcgaggaagcctacagcctggcgatgatggcgaccgaacaa
ttggcaatggagcagcgcagtgccaaagtccaagtgttcgccacagacctcgacgaacgc
gcgatcaatgtcggccggctaggcgtctatcccgatgccatcgccaccgatgtgcccacg
gccaggttgcgtcagtttttcatcaaggaagaccagcattaccgggtacgcaaggacatt
cgcgaaaaagtcctgttcgcccgacataacctgttgtccgatcctccgttctcacagttg
gacctggtggtctgccgtaatctgctcatctacctggatcgggaagtgcaacgggaaata
ttgcgcctgttccacttcgccctgcgcaaagggggttatttgttcctgggcagttcggaa
tcggcggacgtggctgccgacctgtttattgccgtagacaagcaccatcgcatcttccgg
gctcgggaagtggagccggcgcgccgcccggggcggcttcatacgcccgacacgcaagcc
atacgcgccaaacccaaacccaaacccctgcgcaagctgtcctatgctgaaatccatcac
cgtgcattgtccagacgcacaccgcccagcctgatcgtcgatggtgatggcaacattttg
cacatgagtgatggcgtcggccgattcctacgccacgccggtggcgaagtcagccccagc
ctgctgaacctggtactcacaccgctgcgccctgccctgcgcagtagcttgttgcaggct
cataacaccggccagccggtcagctcgggcgccgtgatcaccaccatcgacgatcaacgc
gtcgaaatccaggtacaggttcagccccaccaggacgaacccagtggcagcgaatgcctg
ctggtggtttttcaggttcgcgaagctgatccccatagcccgcctgctatccagcaaacc
gaaggcatggtgttgaacaccctggagcgcgaactgcagcgcacccgtcagcagttgcag
gaaaccatcgagcagtcggacatctccagccaggagctgatggcctcgaacgaagaaatg
caggcgatcaacgaggagctgcgcctggccagcgaagagctggaaaccagcaaggaagag
cttcagtcaatcaacgaagaactgctgacagtcaattacgagctcaagaccaaggtcgat
gaaaccgacaaggtcaacgattacctgagcaacctgatcgcctccacccagatcgccacc
gtgttcgtcgaccgcaacttgcacattcgctggttcacccccggggccaccgccattttc
agcatactgccggtcgacaccggccgctcgctgctcgacatcacccatcgtctggaatac
ccaggcctggcagacgatgcacgcgccgtgatcgaacgcgaaaccacgatcgagcgtgaa
gtgatcggccaggaccagcattggtacctcgcgcgcctgctaccgtaccgggccagtgag
cagaacgtcgacggtacggtgctgacgttcatcgacattaccgagagtcgtgcggccgag
gaacgcttgcgccaaggtgaagagcgcatgcgcctggtcgcagagagcacccatgatttc
gccatcatcctgcttgacgaacaaggcctgatcatcgactggaacacgggcgctgcgctg
attttcggctacgccaaggatgaagtgctgggccttcactatgcgctgattttcaccgag
caggatcgcgaaaacggcgagccggaacgcgaattgcgcgctgcccgccagcatggccgc
ggccaagacgaacgctggcatgtgcgcaaggacggcagccgcttctattgcagtggcgaa
gtctcgcgtctcaagggcagcagcttgcgcggttacgtgaaaatcgcccgtgacctgacc
ggccacaagcgcttgcaggacgaacaaagcaagcgtctggccgagtcgcaaagctccagc
catatgaaggacgagttcttcgcggtgatgtcccatgagctcaagcacccgctgaacctg
atccagctcaatgccgatattttgcgacgcataccatcggtcacaagcaccggcatggcg
agcaaagcggtcaacgtcattcgcgaagcagtcaccagccaggcacgcatcattgatgac
ttgcttgatgttgcgcgcatccgcacgggcaagctcaagctgaagacccaacccgtcgat
ttgtgtgccgtgctgcaaggtatctgcgctgtagcctgcaatgagcagcgcggacgcagt
gttcggctgacgctgccggccgatggcgagccggtcttggtggaggccgacagcacacgt
gtcgagcagatcatctggaacctgttgaacaacgcactgaagttcagccccgccgatggc
gatattctgttgagacttactcggcaggatgagcaggcacgacttgaagtcattgatcag
ggcataggcctcgccgaagactccctggaaggcatttttgagttgttcaaccaggctaca
cccaccggccatgggcgtgaggggctgggtattggcctttccctggtccgtcaactggta
gaagcccacggcggagcggtcagcgtagagtctcccggagtaggccagggttgtactttc
gtcatcacattgcctttgtgcgtgtacacacagcaaccccaggttcagggcgaagcgctg
ccatcagaaggtcggctgacaggggttcgcatactgctggtggatgactcgctcgacgtg
ctggaagtgatggaacaattgctgttgatggaggatgccgacgtcgacgcctacagcgac
ccgaaactggcgctgcaatcggcagcagatgcgcgttacgacgtgatcatttccgacatc
ggcatgcctggcatggatggccatgcactgatccgggcgctacgtggcctggaacatctg
cgctacatccctgccatcgctttgactggctatggggcaagcgctgaccaacacaagtct
cgccagtccggttttgaccgtcacttaaacaagcccgtgggttatgacgacctgattgac
gcgatcgagcgcctgaatggctcagcgtcggtctga

DBGET integrated database retrieval system