KEGG   Pseudomonas putida GB-1: PputGB1_3103Help
Entry
PputGB1_3103      CDS       T00650                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ppg  Pseudomonas putida GB-1
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PputGB1_3103
Enzymes [BR:ppg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     PputGB1_3103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3470792..3471763)
Genome map
AA seq 323 aa AA seqDB search
MAKHGYESGRLNLPFVGHCTFAKAPVCTDWAAIDADVAILGAPNDMGTQWRSGARFGPRG
IREASTLFSFGHAGAYDFEDDATYLTEDQVRMVDVGDADIVHTDMASSNANIESAVRQIL
AAGAMPVVLGGDHSVHAPVIKAFEGHGPIHIVHFDAHLDFVDERHGVRYGHGSPLRRASE
LEHIVGMTQMGIRNVSSSNRDDYDAARDAGSQILSVRDVRRLGCEGVLAKIPEGRNYYIT
IDIDGFDPSIAPGTGTPSHGGFLYYEVLEIIQALARRSHGRIVGMDLVEVAPAYDPTGMT
SILAAQLLMNSIGFIFHARANAR
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcacggttacgagtctggccgcctgaacctgccctttgtgggccattgcacg
ttcgccaaggcgccggtatgcaccgactgggcggcaatcgacgccgatgtggcgattttg
ggtgcacccaacgacatgggcacccagtggcgttcgggtgcgcgctttgggccgcgcggc
atccgtgaggcatcgaccttgttttccttcggccatgccggtgcctatgacttcgaagat
gacgccacctacctgaccgaagaccaggtgcgcatggtcgatgtgggcgacgccgacatc
gtgcacaccgacatggccagcagtaacgccaacatcgagtcggccgtgcggcagattctt
gcggcgggggcgatgccggtggtgctgggcggtgaccattcggtgcatgccccggtgatc
aaggcgttcgaaggccatgggccgatccacatcgtgcatttcgacgcccacctggatttc
gtcgacgagcgccacggcgtgcgctacggccacggcagcccgctgcgccgcgcatcggag
ctggagcacatcgttggcatgacccaaatgggcatccgcaacgtgtcctcatccaaccgc
gacgactacgacgccgcgcgtgacgccggttcgcagattctttcggtgcgtgacgtacgt
cggttgggctgcgagggcgtgctggcgaaaattcctgaaggccgcaactactacatcacc
atcgacatcgacggcttcgacccgtccatcgccccgggcactggcacgccgagccatggc
ggattcttgtactacgaagtgctggagatcatccaggccctggcccggcgcagccatggc
cgcatcgtcggcatggacctggtcgaagtggccccggcctacgaccccaccggcatgacc
tcgatcctggccgcacaattgctgatgaacagcatcggcttcatcttccacgcgcgcgcc
aacgcccgctga

DBGET integrated database retrieval system