KEGG   Pseudomonas putida GB-1: PputGB1_3195Help
Entry
PputGB1_3195      CDS       T00650                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
ppg  Pseudomonas putida GB-1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3576378..3577493)
Genome map
AA seq 371 aa AA seqDB search
MMRQMLVGLVALGLPVFANAEAACSWPAWERFKAELVSADGRVIDPSDARLITTSEGQSY
GLFFALVGNDRDAFAQLLRWTGNNLAEGDLARHLPAWLWGRNEQQQWQVLDANNASDADL
WIAYSLLEAGRLWQQPAYTQLGQRLLWRIAAQTVRKLPGLGVMLLPGDYGFEDAQGTRLN
PSYLPLQLFDRFSEVDPLWGELAANTRRLWLASSPKGFAPDWLLWTPAGKPAADPQHGSA
GDYDAIRVYLWVGMLAKDAVQRNELVAHYAPMAALTQRQGLPPERADARSGEASGQGPAG
FSAALLPLLAASPAHVAGLAAQRQRLRDQPVEAKAYYSQVLVLFGQGWDEARYRFDPHGR
LLPAWSAPCNE
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgccagatgctggtagggttggtcgccctgggcctgcccgttttcgccaatgcc
gaggcggcgtgctcatggcctgcctgggaacgtttcaaggccgagctggtgagtgcggac
ggccgggtgatcgacccgagtgacgcgcgcttgatcaccacgtcggaagggcagagttat
gggttgttcttcgccttggtgggcaatgaccgcgacgccttcgcccagttgctgcgctgg
accggcaacaacctcgccgaaggtgacctggccaggcacctgccggcctggctgtggggg
cgtaacgagcagcagcaatggcaggtgctggacgccaacaacgccagcgatgccgacctg
tggatcgcctacagcctgctggaagcagggcgcttgtggcagcagcccgcatacacgcaa
ctgggccagcgcctgctgtggcgtatcgcggcgcagaccgtgcgcaagctcccaggcctt
ggggtgatgctgctgccaggtgactacggcttcgaggacgcccagggtacccgcctgaac
cccagctacctgccgctgcagctgttcgaccgcttcagcgaggtggaccccttgtgggga
gagctggcggccaatacgcggcgtttgtggttggcttcgtcgccaaagggcttcgccccg
gactggttgctgtggacaccggccggcaagccagcggcagacccgcagcatggcagtgcc
ggtgattacgacgccattcgtgtgtacctgtgggtcggcatgttggccaaggatgcggtg
caacgcaacgaattggtcgcccattacgcgccgatggcggcattgacccagcgccagggg
ctcccccccgagcgcgcggacgcacgcagcggcgaagccagcggccaggggccggccggc
ttttctgcggcattgctgccattgctggcagcctcgccggcgcacgtggccggcttggcg
gcccagcgtcagcgtttgcgcgatcagccggtcgaggccaaggcgtattacagccaggtg
ctggtgctgttcggccaaggctgggatgaggcccgttatcgttttgacccgcacggccgc
ttgttgccggcctggagcgcgccatgcaacgaatga

DBGET integrated database retrieval system