KEGG   Pseudomonas putida GB-1: PputGB1_3388Help
Entry
PputGB1_3388      CDS       T00650                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ppg  Pseudomonas putida GB-1
Brite
Enzymes [BR:ppg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     PputGB1_3388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3820676..3821107)
Genome map
AA seq 143 aa AA seqDB search
MRTSQRGLSLIKSFEGLRLQAYQDSVGVWTIGYGTTRGVKAGMKISKDQAERMLLNDVQR
FEPEVERLIKVPLNQDQWDALMSFTYNLGAANLESSTLRRLLNAGNYAAAAEQFPRWNKA
GGQVLAGLTRRRAAERELFLGAA
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgcggacatcgcaacgcggcttgagcctcatcaagtcgttcgagggcctgcgtctgcag
gcatatcaagattcagtaggcgtctggacgattggctacgggaccactcgtggcgtgaag
gccggcatgaaaatcagcaaggaccaggcagagcgcatgctgctgaacgacgtgcagcgc
ttcgagcctgaagttgagcgcctgatcaaggtgccgctgaatcaggatcagtgggacgcc
ctgatgagcttcacctacaacctgggggcggcaaacctcgaatcgtccacgctccgccga
ctgctcaatgctggcaactacgcagctgctgctgagcagttcccgcgctggaacaaggct
ggcgggcaagtacttgccggcctaacccgtcggcgtgcagctgagcgggagctgttcctg
ggggccgcgtga

DBGET integrated database retrieval system