KEGG   Pseudomonas putida GB-1: PputGB1_3554Help
Entry
PputGB1_3554      CDS       T00650                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ppg  Pseudomonas putida GB-1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PputGB1_3554
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PputGB1_3554
  Lipid metabolism
   00071 Fatty acid degradation
    PputGB1_3554
  Amino acid metabolism
   00350 Tyrosine metabolism
    PputGB1_3554
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PputGB1_3554
   00626 Naphthalene degradation
    PputGB1_3554
Enzymes [BR:ppg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PputGB1_3554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3954309..3955319
Genome map
AA seq 336 aa AA seqDB search
MKAAVVAPGRRVDVVEKTLRPLQHGEALLKMQCCGVCHTDLHVKNGDFGDKTGVVLGHEG
IGVVQEVGPGVTSLKPGDRASVAWFYQGCGHCEYCNSGNETLCREVKNSGYTVDGGMAEA
CIVQADYSVKVPDGLDSAAASSITCAGVTTYKAVKISNIRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNEEQLRFASEMGADLVVNPLNEDAAKVIQAKTGGAHAAVVTAVAKG
AFNSAVDALRAGGRLVAVGLPSESMDLNIPRLVLDGIEVVGSLVGTRQDLQEAFQFAAEG
KVVPKVTLRPIEDINQIFDEMLEGKIKGRMVIQFEG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgttgttgcaccaggccggcgcgtggacgtggtagagaaaaccctgcgc
cccctccagcacggcgaagcgctgctgaagatgcaatgctgcggtgtgtgccacaccgac
ctgcacgtgaaaaatggcgacttcggtgacaagaccggtgtagtactgggccacgaaggc
attggcgtagtccaggaagttggccccggcgtcacctcgctcaagccaggcgaccgcgcc
agcgttgcctggttctatcaaggttgcgggcattgcgagtactgcaatagcggcaacgaa
accctgtgccgcgaagtgaagaactccggctataccgtggacggcggcatggccgaggct
tgcatcgtccaagccgactattcggtcaaagtacccgacggcctcgactccgctgccgcc
agcagcattacctgcgccggcgtcacaacctacaaggcggtgaaaatctccaacatccgc
cccgggcaatggatcgccatctacggcctcggcggcctgggcaacctggccctgcaatat
gccaagaacgtattcaacgccaaagtgatcgccatcgacgtcaacgaagagcaactgcgc
ttcgccagcgagatgggcgcggacctggtcgtcaacccactcaacgaagacgccgcgaag
gttatccaggccaagaccggtggcgcccacgctgccgtggttaccgccgtggccaaaggc
gccttcaactcggccgtcgatgccttgcgcgctggcgggcgactggttgccgtcgggctg
ccgtcggaatccatggacctgaacattccccgcctggtgctggatgggatcgaagtggtg
ggctcgctggtaggtacacgccaggacctgcaggaggcgttccagtttgccgctgaaggc
aaagtggtacccaaggtgaccctgcggccgatcgaagatatcaaccagatctttgacgag
atgctggagggcaagatcaaaggccgcatggtgatccagttcgaaggctga

DBGET integrated database retrieval system