KEGG   Pseudomonas putida GB-1: PputGB1_3651Help
Entry
PputGB1_3651      CDS       T00650                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ppg  Pseudomonas putida GB-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PputGB1_3651
Enzymes [BR:ppg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PputGB1_3651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4055667..4057736
Genome map
AA seq 689 aa AA seqDB search
MSETALHRLATLVGLSRDWIDANARPQRVSDEVLRNILAGLGHPASDDTAIAASLRAVEA
AEDSEHLPPLLTAEQGQPLALARYFSAASVAHCTLEDQASLTLSLDQQARLPGDLPIGYH
QVEIDSRRFTVAIAPPRCHSLEDDVQQPPPRCWGLAVQLYSLRRPGDGGYGDCLALEQLA
RSAAERGADALAISPIHALSAIDQEHYSPYSPSSRLLLNTLYASPASLLGEREVRMAIEA
CGLEQQLEELEQRPLVDWPRAASARLRLLEALYQGFSQGNHPLRSDFDSFRAAGGQALEH
HCRFEVLQAQAVEHGLGADWRNWPKAWHDPYHPEVEAFASAYPAKVEFHAFCQWLTERGL
QRAHEAARGNGMAVGLIADLAVGADGAGSQAWSRQDELLAGLKVGAPPDILNRAGQDWGI
CAFSPEGLKRNGYRAFIEMLRANLAHAGGLRIDHVMGLRRLWLIPQGAKPSEGAYLNYPL
DDLLRLLALESVRHQAIILGEDLGTVPDGLRETLAEKAVLGMRVLPFEQTQPGQFKPILD
WPDNALATTGTHDLAPLAGWLENRDIDWSQRLQLIDAATELHWRHDRQKEHDGLRRTLEA
NYGELKDNDAVIDAAIRYVGHTRAPLVLVPLEDLLGCDEQPNLPGTTSGHPNWRRRFAQP
VRELLDDEHAARRLELLAQAREQAWERDR
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaccgccctgcaccgtctggcgaccctcgtcgggctcagccgcgactggatc
gacgccaatgcccggcctcagcgtgtcagcgacgaagtgctgcgcaatatcctcgcaggc
cttggccacccagccagcgatgacacggccattgccgccagcctgcgtgcggtggaagcc
gccgaggacagtgagcacctgccgcccttgctgaccgccgagcagggccaaccgctggcg
ctggcgcgctacttcagcgccgccagcgtcgcccactgcaccctggaagaccaggcctcg
cttaccctgagccttgaccagcaggcgcgtctgcccggtgatctgccgattggctaccat
caggtagaaatcgacagccgccgcttcactgtggccattgccccgccacgctgccacagc
ctggaagacgatgtgcaacaaccaccaccacgctgctggggcctggcggtgcagctgtac
agcctgcgtcgccccggcgatggtggctacggcgactgcctggcactggagcagttggca
cgctcggcagccgagcgcggcgccgatgccttggccatcagcccgatccacgccttgtcg
gccatcgaccaggaacactacagcccctactcgccgtccagtcgcctgctgctcaacacc
ctgtacgccagccccgcgtccttgctgggtgaacgggaggtgcgcatggccatcgaagcc
tgcggcctggaacagcaactggaggagctggagcaacgcccattggtcgactggccacgc
gccgccagcgcccgcctgcgcctgctagaagcgctgtaccagggcttcagccaaggcaac
cacccgctacgcagcgatttcgacagcttccgcgcagccggtggccaggcgctggaacac
cactgtcgcttcgaggtgctccaggcccaggcagtcgagcatggcctgggcgccgactgg
cgcaactggcccaaggcctggcacgacccgtaccacccggaagtggaagcctttgccagc
gcctacccggccaaggtcgagttccatgccttttgccagtggctgaccgaacgcggcctg
cagcgtgcccacgaggcagcccgtggcaacggcatggccgtgggcctgatcgccgacctg
gcggtgggcgccgacggcgccggcagccaggcttggagccgccaggatgaactgctggcc
ggcctgaaagtgggggcgccgcccgacatcctcaaccgcgccgggcaggactggggtatc
tgcgccttctcgcccgagggcctcaagcgcaacggctaccgcgccttcatcgagatgctg
cgggccaacctcgcccacgctggcggcctgcgcatcgaccatgtgatgggcctgcgccgg
ctgtggctgatcccgcagggggcaaagcccagcgaaggcgcctacctcaattacccgctg
gacgacctgttgcgcctgttggcgctggaatcggtgcgccaccaggcgatcattcttggc
gaagacctgggcaccgtacccgatggcctgcgcgagacactggccgaaaaagccgtgctg
ggcatgcgcgtgctgcccttcgagcagacccagcccggccagttcaagccgattctcgac
tggccggacaacgccctggccaccacgggcacccatgacctcgcgccattggccggctgg
ctggaaaaccgcgacatcgactggagccagcgcttgcaactgatcgacgccgctaccgag
ctgcactggcgccacgaccgccagaaagaacacgacggcctgcgccgcaccctggaggcc
aactatggcgagctgaaggacaatgacgcggtaatcgacgccgccatccgctacgttggc
catacccgcgcaccgctggtgctggtgccgctggaagacttgctgggttgcgacgagcag
cccaacctgccggggaccaccagcggccaccccaattggaggcggcgcttcgcccagcca
gtgcgcgaactgctcgacgacgagcatgccgctcgccgcctggagctgctggcccaggcc
cgcgaacaagcctgggagcgtgaccgatga

DBGET integrated database retrieval system