KEGG   Pseudomonas putida GB-1: PputGB1_3651Help
Entry
PputGB1_3651      CDS       T00650                                 

Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg00500  Starch and sucrose metabolism
ppg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PputGB1_3651
Enzymes [BR:ppg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PputGB1_3651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: ABY99542
JGI: PputGB13651
UniProt: B0KMT8
Position
4055667..4057736
Genome map
AA seq 689 aa AA seqDB search
MSETALHRLATLVGLSRDWIDANARPQRVSDEVLRNILAGLGHPASDDTAIAASLRAVEA
AEDSEHLPPLLTAEQGQPLALARYFSAASVAHCTLEDQASLTLSLDQQARLPGDLPIGYH
QVEIDSRRFTVAIAPPRCHSLEDDVQQPPPRCWGLAVQLYSLRRPGDGGYGDCLALEQLA
RSAAERGADALAISPIHALSAIDQEHYSPYSPSSRLLLNTLYASPASLLGEREVRMAIEA
CGLEQQLEELEQRPLVDWPRAASARLRLLEALYQGFSQGNHPLRSDFDSFRAAGGQALEH
HCRFEVLQAQAVEHGLGADWRNWPKAWHDPYHPEVEAFASAYPAKVEFHAFCQWLTERGL
QRAHEAARGNGMAVGLIADLAVGADGAGSQAWSRQDELLAGLKVGAPPDILNRAGQDWGI
CAFSPEGLKRNGYRAFIEMLRANLAHAGGLRIDHVMGLRRLWLIPQGAKPSEGAYLNYPL
DDLLRLLALESVRHQAIILGEDLGTVPDGLRETLAEKAVLGMRVLPFEQTQPGQFKPILD
WPDNALATTGTHDLAPLAGWLENRDIDWSQRLQLIDAATELHWRHDRQKEHDGLRRTLEA
NYGELKDNDAVIDAAIRYVGHTRAPLVLVPLEDLLGCDEQPNLPGTTSGHPNWRRRFAQP
VRELLDDEHAARRLELLAQAREQAWERDR
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaccgccctgcaccgtctggcgaccctcgtcgggctcagccgcgactggatc
gacgccaatgcccggcctcagcgtgtcagcgacgaagtgctgcgcaatatcctcgcaggc
cttggccacccagccagcgatgacacggccattgccgccagcctgcgtgcggtggaagcc
gccgaggacagtgagcacctgccgcccttgctgaccgccgagcagggccaaccgctggcg
ctggcgcgctacttcagcgccgccagcgtcgcccactgcaccctggaagaccaggcctcg
cttaccctgagccttgaccagcaggcgcgtctgcccggtgatctgccgattggctaccat
caggtagaaatcgacagccgccgcttcactgtggccattgccccgccacgctgccacagc
ctggaagacgatgtgcaacaaccaccaccacgctgctggggcctggcggtgcagctgtac
agcctgcgtcgccccggcgatggtggctacggcgactgcctggcactggagcagttggca
cgctcggcagccgagcgcggcgccgatgccttggccatcagcccgatccacgccttgtcg
gccatcgaccaggaacactacagcccctactcgccgtccagtcgcctgctgctcaacacc
ctgtacgccagccccgcgtccttgctgggtgaacgggaggtgcgcatggccatcgaagcc
tgcggcctggaacagcaactggaggagctggagcaacgcccattggtcgactggccacgc
gccgccagcgcccgcctgcgcctgctagaagcgctgtaccagggcttcagccaaggcaac
cacccgctacgcagcgatttcgacagcttccgcgcagccggtggccaggcgctggaacac
cactgtcgcttcgaggtgctccaggcccaggcagtcgagcatggcctgggcgccgactgg
cgcaactggcccaaggcctggcacgacccgtaccacccggaagtggaagcctttgccagc
gcctacccggccaaggtcgagttccatgccttttgccagtggctgaccgaacgcggcctg
cagcgtgcccacgaggcagcccgtggcaacggcatggccgtgggcctgatcgccgacctg
gcggtgggcgccgacggcgccggcagccaggcttggagccgccaggatgaactgctggcc
ggcctgaaagtgggggcgccgcccgacatcctcaaccgcgccgggcaggactggggtatc
tgcgccttctcgcccgagggcctcaagcgcaacggctaccgcgccttcatcgagatgctg
cgggccaacctcgcccacgctggcggcctgcgcatcgaccatgtgatgggcctgcgccgg
ctgtggctgatcccgcagggggcaaagcccagcgaaggcgcctacctcaattacccgctg
gacgacctgttgcgcctgttggcgctggaatcggtgcgccaccaggcgatcattcttggc
gaagacctgggcaccgtacccgatggcctgcgcgagacactggccgaaaaagccgtgctg
ggcatgcgcgtgctgcccttcgagcagacccagcccggccagttcaagccgattctcgac
tggccggacaacgccctggccaccacgggcacccatgacctcgcgccattggccggctgg
ctggaaaaccgcgacatcgactggagccagcgcttgcaactgatcgacgccgctaccgag
ctgcactggcgccacgaccgccagaaagaacacgacggcctgcgccgcaccctggaggcc
aactatggcgagctgaaggacaatgacgcggtaatcgacgccgccatccgctacgttggc
catacccgcgcaccgctggtgctggtgccgctggaagacttgctgggttgcgacgagcag
cccaacctgccggggaccaccagcggccaccccaattggaggcggcgcttcgcccagcca
gtgcgcgaactgctcgacgacgagcatgccgctcgccgcctggagctgctggcccaggcc
cgcgaacaagcctgggagcgtgaccgatga

DBGET integrated database retrieval system