KEGG   Pseudomonas putida GB-1: PputGB1_3757Help
Entry
PputGB1_3757      CDS       T00650                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg00020  Citrate cycle (TCA cycle)
ppg00640  Propanoate metabolism
ppg00660  C5-Branched dibasic acid metabolism
ppg01100  Metabolic pathways
ppg01110  Biosynthesis of secondary metabolites
ppg01120  Microbial metabolism in diverse environments
ppg01130  Biosynthesis of antibiotics
ppg01200  Carbon metabolism
Module
ppg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PputGB1_3757
   00640 Propanoate metabolism
    PputGB1_3757
   00660 C5-Branched dibasic acid metabolism
    PputGB1_3757
Enzymes [BR:ppg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PputGB1_3757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: ABY99647
JGI: PputGB13757
UniProt: B0KNW8
Position
complement(4180128..4181294)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGFAVDTPEAAAEACDKIGGSEWVVKAQVHAGGRGKAGGV
KLVRSKEDAKAFAAQWLGKRLVTYQTDANGQPVTKILVESCTDIAKELYLGAVVDRSSRR
IVFMASTEGGVDIEKVAHETPEKIIKATIDPLVGAQPFQGRELAFQLGLEGKQVAQFAKI
FVGLAKLFKEHDLALLEVNPLVIKADGDLHCLDAKINIDANAMYRQPKLKTFHDPSQDDP
REAHAASFELNYVALEGNIGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVTE
AFKIILSDSNVAAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGNNAELGAKV
LAESGLNIIAATSLTDAAQQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgagtatcagggtaagcagctgttcgctgaatacggcctgccagtttcc
aagggtttcgcagtcgatacccctgaagctgcagcagaagcttgcgacaagatcggcggt
tccgagtgggttgtaaaagctcaggttcacgcgggtggtcgcggcaaagcgggcggcgtc
aagctggttcgcagcaaggaagacgccaaggcgttcgctgcgcaatggttgggcaagcgc
ctggtaacctaccagaccgatgccaacggtcagccagtgaccaagatcctggtcgaatcc
tgcactgacatcgccaaagagctgtacctgggcgctgtagtcgatcgctcgagccgccgt
atcgtgttcatggcctccaccgaaggtggcgtggacatcgagaaagtcgctcacgaaact
cctgagaagatcatcaaggctactatcgatccgctggtcggcgctcagccgttccagggt
cgtgaactggcattccagctgggtctggaaggcaagcaagttgcacagttcgccaagatt
ttcgtaggcctggccaagctgttcaaagaacatgacctggccctgctggaagtcaacccg
ctggtcatcaaggccgacggcgacctgcactgcctggatgcgaagatcaacatcgacgca
aacgccatgtaccgtcagcctaagctgaaaaccttccacgacccgtctcaggacgaccct
cgtgaagcccacgctgccagcttcgagctgaactacgtggccctggaaggcaacatcggc
tgcatggtcaacggtgctggcctggccatgggtaccatggacatcgtcaacctgcacggc
ggcaagccggccaacttcctcgacgttggcggtggtgctaccaaagagcgcgttaccgaa
gcgttcaagatcattctgtccgacagcaatgtcgcggccgttctggtcaacatcttcggc
ggcatcgttcgctgcgacatgattgccgaaggcatcatcggtgcagtgaaagaagtcggc
gttaaagttccggttgtggttcgcctcgaaggcaacaacgccgaactgggcgctaaagta
ctggcagaaagcggtttgaacatcattgcggcaaccagcctgaccgacgctgctcaacaa
gttgtcaaagctgcggagggcaagtaa

DBGET integrated database retrieval system