KEGG   Pseudomonas putida GB-1: PputGB1_3759Help
Entry
PputGB1_3759      CDS       T00650                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ppg  Pseudomonas putida GB-1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PputGB1_3759
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PputGB1_3759
  Amino acid metabolism
   00310 Lysine degradation
    PputGB1_3759
Enzymes [BR:ppg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PputGB1_3759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4182997..4184217)
Genome map
AA seq 406 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKKPGEAVKRDELIVDIETDKVVLEVLATADGVLGDIV
KGEGDTVLSDEVLGSIVEGGAAAAPAAAAAPAAAPAAAAADAGEDDPVAAPAARKLAEEN
GIDLATVAGTGKGGRVTKEDVVAAVANKKSAPAAAPAAKPAAAAAPVVVAAGDRTEKRVP
MTRLRAKIAERLVEAQSNMAMLTTFNEVDMTEVMALRSKYKDLFEKTHNGVRLGFMSFFV
KAATEALKRFPAVNASIDGNDIVYHGFADVGVAVSSDRGLVVPVLRNAESMSLAEIENGI
ATFGKKARDGKLSIEEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNIIQRPMAVN
GQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPSRLLLDI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagccccaaccttcccggaatcggttgccgatggcaccgttgcc
acctggcacaagaagccgggcgaagccgtcaagcgtgacgagctgatcgtcgacatcgag
accgacaaggttgtcctggaagttctggctaccgccgatggcgtgctgggcgacatcgtc
aagggcgagggcgacaccgtcctgtccgacgaagtgctgggttcgatcgttgaaggcggt
gctgccgccgctccagccgcagctgccgcgcctgctgctgctccggccgctgctgccgct
gatgctggcgaagatgacccggttgctgccccggccgcgcgcaagctggctgaagaaaac
ggcatcgacctggctaccgttgccggtactggcaaaggcggtcgcgtcaccaaggaagac
gtggtggctgctgttgccaacaagaagtcggcccctgccgctgcaccggctgccaagcct
gctgccgctgctgcaccggttgtcgtcgccgctggcgaccgcaccgagaagcgcgtgccg
atgactcgcctgcgtgccaagatcgccgagcgtctggtcgaagcccagtcgaacatggcc
atgctgaccaccttcaacgaagtcgacatgaccgaagtcatggccctgcgttcgaagtac
aaggacctgttcgagaagacccataacggcgtacgcctgggcttcatgtcgttcttcgtc
aaggccgccaccgaagccctgaagcgcttcccggctgtcaacgcctcgatcgacggtaac
gacattgtctaccacggcttcgctgacgtgggtgttgcggtttccagcgaccgtggcctg
gtggtcccggtactgcgcaacgccgagtcgatgagcctggctgaaatcgaaaacggcatt
gccaccttcggcaagaaagcccgtgacggcaaactgtcgatcgaagaaatgaccggcggt
accttcaccatcaccaacggcggcaccttcggttcgatgatgtcgaccccgatcgtcaac
ccgccgcaggccgcgatcctcggcatgcacaacatcatccagcgcccgatggccgtcaat
ggtcaggtcgtgattcgcccgatgatgtacctggcactgtcctacgatcaccgcctgatc
gatggtaaggaagcggtaaccttcctggtcaccatcaagaacctgctggaagatccgtct
cgcctgctgctggacatctaa

DBGET integrated database retrieval system