KEGG   Pseudomonas putida GB-1: PputGB1_3763Help
Entry
PputGB1_3763      CDS       T00650                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
ppg  Pseudomonas putida GB-1
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PputGB1_3763
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PputGB1_3763
   00650 Butanoate metabolism
    PputGB1_3763
  Energy metabolism
   00190 Oxidative phosphorylation
    PputGB1_3763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4189830..4190198)
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNLSRSGLYDWMAQRVSAVVLAAYFLFLIGYVVAHPGIDYTQWHGLFSNNAMRIF
SLLALVALGAHAWVGMWTIATDYLTPMSFGKSATAIRFLFQAVCGVAMFAYFVWGVQILW
GI
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaatgtcacgaacctgtcgcgttcgggcctctatgactggatggcgcagcgc
gtttctgcggtcgttctcgcggcttacttcctcttcctgatcggctacgtggtcgcccac
ccaggcatcgactacacccagtggcatggtctgttctccaacaacgcgatgcggatcttc
agtctgctggccctcgttgccctgggcgctcacgcctgggtcggcatgtggaccattgca
accgactacctgacgcctatgtcgttcggcaagtcggcaactgcgattcgtttcctgttc
caggcggtatgcggcgttgcgatgttcgcttacttcgtctggggtgtgcagattctctgg
ggtatctga

DBGET integrated database retrieval system