KEGG   Pseudomonas putida GB-1: PputGB1_3763Help
Entry
PputGB1_3763      CDS       T00650                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg00020  Citrate cycle (TCA cycle)
ppg00190  Oxidative phosphorylation
ppg00650  Butanoate metabolism
ppg01100  Metabolic pathways
ppg01110  Biosynthesis of secondary metabolites
ppg01120  Microbial metabolism in diverse environments
ppg01130  Biosynthesis of antibiotics
ppg01200  Carbon metabolism
Module
ppg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ppg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PputGB1_3763
   00650 Butanoate metabolism
    PputGB1_3763
  Energy metabolism
   00190 Oxidative phosphorylation
    PputGB1_3763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ABY99653
JGI: PputGB13763
UniProt: B0KNX4
Position
complement(4189830..4190198)
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNLSRSGLYDWMAQRVSAVVLAAYFLFLIGYVVAHPGIDYTQWHGLFSNNAMRIF
SLLALVALGAHAWVGMWTIATDYLTPMSFGKSATAIRFLFQAVCGVAMFAYFVWGVQILW
GI
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaatgtcacgaacctgtcgcgttcgggcctctatgactggatggcgcagcgc
gtttctgcggtcgttctcgcggcttacttcctcttcctgatcggctacgtggtcgcccac
ccaggcatcgactacacccagtggcatggtctgttctccaacaacgcgatgcggatcttc
agtctgctggccctcgttgccctgggcgctcacgcctgggtcggcatgtggaccattgca
accgactacctgacgcctatgtcgttcggcaagtcggcaactgcgattcgtttcctgttc
caggcggtatgcggcgttgcgatgttcgcttacttcgtctggggtgtgcagattctctgg
ggtatctga

DBGET integrated database retrieval system