KEGG   Pseudomonas putida GB-1: PputGB1_3832Help
Entry
PputGB1_3832      CDS       T00650                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
ppg  Pseudomonas putida GB-1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PputGB1_3832
DNA repair and recombination proteins [BR:ppg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     PputGB1_3832
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PputGB1_3832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(4270794..4271396)
Genome map
AA seq 200 aa AA seqDB search
MSFSPLIRQLIDGLRILPGVGQKTAQRMALQLLERDRSGGLRLAQALTQAMEGVGHCRQC
RTLTEQELCPQCADTRRDDTQLCVVEGPTDVYAVEQTGYRGRYFVLKGHLSPLDGLGPEA
IGIPQLMARIEEQGTFTEVILATNPTVEGEATAHYIAQLLSEKGLAATRIAHGVPLGGEL
ELVDGGTLAHAIAGRRPISL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcagccccctcattcgccaactgatcgatggtttgcgcatcctcccaggtgtc
ggccagaaaaccgcccagcgcatggccttgcagttgctcgagcgagaccgcagcggcggc
ctgcgcctggcccaggcgctgacccaggccatggagggggtaggccattgccgccagtgc
cgcaccctgaccgagcaggagctgtgcccgcaatgcgccgacacgcgccgtgacgatacc
cagttgtgcgtggtcgaggggccgaccgatgtgtatgcggtggaacagacgggctaccgt
ggccgttacttcgtactcaagggccacctgtcgccgctggacggcttggggccggaggcg
atcggcattccgcaactgatggcccgcatcgaggagcagggcacctttaccgaggtgatc
ctggcgaccaacccgacggtggagggcgaggcgacggcgcattacattgcgcagttgttg
agcgagaaggggttggcggcaacgcggattgcccatggtgtgccgctgggcggcgagctt
gagctggtggatggcgggaccttggcccatgccattgcagggcgccggcctatttcgctc
tga

DBGET integrated database retrieval system