KEGG   Pseudomonas putida GB-1: PputGB1_3832Help
Entry
PputGB1_3832      CDS       T00650                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ppg  Pseudomonas putida GB-1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ppg03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4270794..4271396)
Genome map
AA seq 200 aa AA seqDB search
MSFSPLIRQLIDGLRILPGVGQKTAQRMALQLLERDRSGGLRLAQALTQAMEGVGHCRQC
RTLTEQELCPQCADTRRDDTQLCVVEGPTDVYAVEQTGYRGRYFVLKGHLSPLDGLGPEA
IGIPQLMARIEEQGTFTEVILATNPTVEGEATAHYIAQLLSEKGLAATRIAHGVPLGGEL
ELVDGGTLAHAIAGRRPISL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcagccccctcattcgccaactgatcgatggtttgcgcatcctcccaggtgtc
ggccagaaaaccgcccagcgcatggccttgcagttgctcgagcgagaccgcagcggcggc
ctgcgcctggcccaggcgctgacccaggccatggagggggtaggccattgccgccagtgc
cgcaccctgaccgagcaggagctgtgcccgcaatgcgccgacacgcgccgtgacgatacc
cagttgtgcgtggtcgaggggccgaccgatgtgtatgcggtggaacagacgggctaccgt
ggccgttacttcgtactcaagggccacctgtcgccgctggacggcttggggccggaggcg
atcggcattccgcaactgatggcccgcatcgaggagcagggcacctttaccgaggtgatc
ctggcgaccaacccgacggtggagggcgaggcgacggcgcattacattgcgcagttgttg
agcgagaaggggttggcggcaacgcggattgcccatggtgtgccgctgggcggcgagctt
gagctggtggatggcgggaccttggcccatgccattgcagggcgccggcctatttcgctc
tga

DBGET integrated database retrieval system