KEGG   Pseudomonas putida GB-1: PputGB1_3906Help
Entry
PputGB1_3906      CDS       T00650                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ppg  Pseudomonas putida GB-1
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PputGB1_3906
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PputGB1_3906
Enzymes [BR:ppg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PputGB1_3906
Two-component system [BR:ppg02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   PputGB1_3906
Bacterial motility proteins [BR:ppg02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PputGB1_3906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4350449..4351579)
Genome map
AA seq 376 aa AA seqDB search
MAVKVLVVDDSGFFRRRVSEILSADPTIQVVGTATNGKEAIDQALALKPDVITMDYEMPM
MDGITAVRHIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDYLPKNFEDISRNPDKVKQ
LLCEKVHTISRSNRRIGSYARTAPVAAPAPASSHAPASTFTSPAQARPAVPARAAAPAPA
ATHSPAPKRKPYKLVAIGTSTGGPVALQRVLTQLPANFPAPIVLIQHMPAAFTKAFAERL
DKLCRISVKEAEDGDMLRPGLALLAPGGKQMMIDGRGTVKILPGDERLNYKPCVDITFGS
AAKSYGDKVLSVVLTGMGADGREGARLLKQGGSTVWAQDEASCVIYGMPMAIVKANLADA
VYSLDEIGKHLVEACV
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaaggtcctggtggtggatgattccggtttcttccgccgccgcgtctcggaa
atcctctcggcggatccgacgatccaggtagtgggtaccgcgaccaacggcaaggaagca
atcgaccaggcgctggcgctcaagcccgatgtcatcaccatggactacgaaatgcccatg
atggatggcatcactgctgtgcggcacatcatgcagcgctgcccgacgcccgtattgatg
ttctcgtcgttgacccatgagggcgcccgcgtgacccttgacgcgctggacgccggcgcg
gtggattacctgccgaaaaacttcgaagacatctcgcgcaaccccgacaaggtcaagcaa
ctgctgtgcgaaaaggtgcataccatttcccgcagcaaccgccgtattggcagctatgcc
agaacggccccggtcgccgcgcctgcgcctgccagtagccacgcgcccgccagcaccttc
accagcccggcgcaggcgcgcccggctgtgcctgcccgtgcagcggccccggccccggcg
gccacgcactcgccagcgcccaagcgcaagccctacaaactggtggctatcggcacctcc
acgggtggcccagtggccctgcagcgggtattgacccaattgccggccaatttcccggcg
ccgatcgtgctgatccagcacatgccggcggccttcaccaaggcctttgccgagcgcctg
gacaagctgtgccgcatcagcgtcaaggaggccgaggacggcgacatgctgcgccctggc
ctggccctgctggcccctggtggcaagcagatgatgatcgatggccgtggcacggtgaag
atcctgcccggtgacgagcgcctgaactacaaaccctgcgtggacatcacgttcggttcg
gcggccaagtcgtatggtgacaaggtgttgtcggtggtgctcaccggcatgggcgccgat
ggccgcgaaggcgcgcgcctgctcaagcaggggggcagcacggtgtgggcccaggatgaa
gccagctgcgtgatttatggcatgcccatggccatcgtcaaggccaacctggccgatgcg
gtgtacagcctggacgaaatcggcaagcacctggtggaggcgtgcgtctga

DBGET integrated database retrieval system