KEGG   Pseudomonas putida GB-1: PputGB1_4337Help
Entry
PputGB1_4337      CDS       T00650                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ppg  Pseudomonas putida GB-1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PputGB1_4337 (glpK)
Enzymes [BR:ppg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PputGB1_4337 (glpK)
Exosome [BR:ppg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PputGB1_4337 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4848221..4849720
Genome map
AA seq 499 aa AA seqDB search
MTDTQDKHYIIALDQGTTSSRAIIFDRDANVVGTSQREFAQHYPQAGWVEHDPMEIFATQ
SATMVEALAQAGISHAQVAALGITNQRETTVVWDKETGRPVYNAIVWQCRRSTEICAQLK
RDGHEAYIRETTGLVTDPYFSGTKLKWILDNVEGARERAERGELLFGTIDTWLIWKFSGG
KVHVTDYTNASRTLMFNIHSLQWDDKLLEILGIPRQMLPEVRPSSEVYGHTKSGIAIAGI
AGDQQSALFGQMCVEPGQAKNTYGTGCFLLMNTGDQAVKSSHGLLTTIACGPRGEVAYAL
EGAVFNGGSTVQWLRDELKIVNDALDTEYFASKVKDSNGVYLVPAFTGLGAPYWDPYARG
ALFGLTRGVKVDHIIRAALESIAYQTRDVLDAMQQDCGQHLSELRVDGGAVANNFLMQFQ
ADILGTCVERPQMRETTALGAAYLAGLACGFWSGLDELRDKAIIEREFSPQLDETQKEKL
YAGWKKAVERTRDWEDHEA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgacagacacccaggacaagcactacatcatcgccctggaccagggcaccaccagttcg
cgggcgattatcttcgaccgtgatgccaacgtggtgggcacctcccagcgcgagttcgcc
cagcactacccgcaggcgggctgggtcgagcacgacccgatggagatcttcgccacacag
agcgcgaccatggtcgaggccttggcccaggctggtatcagccacgcccaggtcgccgcg
ctgggcattaccaaccagcgcgaaaccaccgtggtatgggacaaggaaaccgggcgcccg
gtgtacaacgccattgtctggcagtgccgccgcagcaccgagatctgtgcccagctcaag
cgtgacggccatgaagcgtacattcgtgaaaccaccggcctggtcaccgacccgtacttc
tccggtaccaagctgaagtggatcctcgacaatgtcgaaggcgcccgtgaacgcgccgag
cgtggcgaactgttgttcggcaccatcgacacctggctgatctggaagttttcgggtggc
aaggtgcacgtcaccgactacaccaacgcctcgcgcacgctgatgttcaacatccacagc
ctgcagtgggacgacaaactgctggaaatcctgggcatcccgcggcagatgctgcccgag
gtgcgcccgtcctcggaagtgtacggccacaccaagagcggcatcgccatcgccggtatc
gccggagaccagcagtcggcactgttcggccagatgtgcgtggagccaggccaggccaag
aatacctacggcaccggctgcttcctgctgatgaacaccggcgaccaggcggtgaagtcg
tcccatggcctgctcaccaccattgcctgcggcccacgcggtgaagtggcctatgcgctg
gaaggcgcggtattcaacggtggttccaccgtgcaatggctacgtgacgaactgaagatc
gtcaacgacgccttggataccgagtacttcgccagcaaggtcaaggacagcaacggcgtc
tacctggtgccagccttcaccggcctgggtgccccgtactgggacccgtatgcccgtggt
gcactgttcggcctgactcgcggcgtgaaggtggaccacatcatccgcgccgcgctggaa
tcgatcgcctaccagacccgcgacgtgctcgacgccatgcagcaggactgcggccagcac
ctgtccgagctgcgcgtggacggcggtgcggtggccaacaacttcctcatgcagttccag
gcagacatcctcggcacctgcgtggaacggccacagatgcgcgaaaccacggcgctgggc
gccgcctacctggcgggcctggcctgtggcttctggagcggcctggacgagctgcgcgac
aaggcgatcatcgagcgcgagttcagcccgcagctggacgaaacgcagaaagagaagctg
tatgccggctggaagaaggcggtcgagcgaacccgtgactgggaagaccacgaggcataa

DBGET integrated database retrieval system