KEGG   Pseudomonas putida GB-1: PputGB1_4517Help
Entry
PputGB1_4517      CDS       T00650                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ppg  Pseudomonas putida GB-1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ppg00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ppg00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5054506..5055996)
Genome map
AA seq 496 aa AA seqDB search
MMTMPLSKLFAHASRDPLIRELTLDSRNVRPGDLFLAVPGAKVDGREHIADALTRGAAAV
AYEEQGATVLPLTEVPLIPVKGLIAQLSDVAGRFYGEPSRQLNLVGVTGTNGKTSVTQLV
AQALDLLGQRCGLIGTLGTGFYGELQSGRLTTPDPIAVQSTLYDLKKQGAKAVAMEVSSH
ALEQGRVAALEFDIAVMTNLSRDHLDYHGSMEAYEAAKAKLFAWPSLRCQVVNLDDAFGR
RLAADFARRPSVDHIDTRLLSYSLENPDASLFCREAAFSDDGVRATIVTAQGERILRSQL
LGRFNLSNMLAAVATLLALDYALDEILKVTPQLHGPVGRMQRLGGGDKPLVVVDYAHTPD
ALEKVLEALRPHAHGKLLCLFGCGGDRDRGKRPLMAEVAERLADRVLVTDDNPRTEDPQR
IFDDIRPGFARPVSVEFVAGRGEAIAQLIASAAANDVIVLAGKGHEDYQEINGERHDFSD
LTEAEKALAAWEAPHA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgatgacaatgccattaagcaaacttttcgcccacgccagccgtgacccgctgattcgt
gaactgaccctggacagccgcaacgtgcgcccgggtgacctgttcctggccgtgccgggt
gccaaggtcgatggccgcgagcatatcgccgatgccttgacccgtggtgccgccgccgtg
gcctatgaagagcagggcgccaccgtgctgccgctgaccgaagtgccattgattccggtc
aagggcctgatcgcacagctgtcggatgtcgccgggcgtttttatggcgaacccagccgc
cagctgaacctggtcggtgtgaccgggaccaacggcaagaccagcgttacccaattggtg
gcccaggcgctcgacctgctcggccagcgctgcggcttgatcggcaccctgggtaccggc
ttctacggggagctgcagagcggccgtctgaccacgcccgacccgattgccgtgcagtcg
accctttacgatttgaaaaagcagggcgccaaggctgtggccatggaggtttcctctcac
gccctggagcaaggccgagtcgccgcattggagttcgacatcgcggtgatgaccaacctg
tcccgcgaccacctcgactaccacggcagcatggaggcctatgaggccgccaaggccaag
ctgttcgcctggcccagcctgcgttgccaggtggtcaacctggatgacgcctttggccgt
cgcctggccgctgactttgcccgccgtccgagcgtcgaccatatcgacacccggctgctg
agctacagcctggaaaacccagatgcctcgctgttctgtcgcgaggccgcgttcagtgac
gatggcgtgcgcgcgacgatcgttaccgcacaaggtgagcgtatcctgcgcagtcagctg
ctggggcgcttcaacctgagcaacatgctcgccgctgtcgcgacactgctggcactggat
tatgcactggacgaaatcctcaaggtcaccccgcaactgcacggtccggtaggccgtatg
cagcgcctgggtggcggcgacaaaccgctggtggtggtcgattacgcccacaccccggac
gcccttgaaaaagtgctcgaagcgctgcgcccacacgcccacggtaagttgctgtgcctg
ttcggctgcggcggcgaccgtgatcgcggcaagcgcccgctgatggccgaagtggccgag
cgcctggccgatcgcgtactggtcaccgatgacaacccacgtaccgaagacccacagcgc
atcttcgacgacatccgtcccggtttcgcccggcctgtctcggtcgagttcgttgccggt
cgtggcgaggccatcgcgcagttgattgcctccgctgctgccaacgacgtgatcgtgctg
gctggcaaggggcacgaggattaccaggagatcaatggcgagcgccatgacttctccgat
ttgaccgaagccgaaaaggcacttgcagcctgggaggcgccacatgcttaa

DBGET integrated database retrieval system