KEGG   Pseudomonas putida GB-1: PputGB1_4716Help
Entry
PputGB1_4716      CDS       T00650                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ppg  Pseudomonas putida GB-1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PputGB1_4716 (tpiA)
   01230 Biosynthesis of amino acids
    PputGB1_4716 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PputGB1_4716 (tpiA)
   00051 Fructose and mannose metabolism
    PputGB1_4716 (tpiA)
   00562 Inositol phosphate metabolism
    PputGB1_4716 (tpiA)
Enzymes [BR:ppg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PputGB1_4716 (tpiA)
Exosome [BR:ppg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PputGB1_4716 (tpiA)
  Exosomal proteins of bladder cancer cells
   PputGB1_4716 (tpiA)
  Exosomal proteins of melanoma cells
   PputGB1_4716 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5270056..5270811)
Genome map
AA seq 251 aa AA seqDB search
MRRPMVAGNWKMHGTRASVAELTEGLSNLALPSGVEVAVFPPALFINQVIDGLAGKEITV
GAQNSAVQPEQGALTGEVAPEQLVEAGCKLVLIGHSERRQVIGETDEVLNRKFAAAQAKG
LKPVLCIGETLEEREAGKTLEVVGRQLSSIIEAFGVKAFANAVIAYEPVWAIGTGLTATP
QQAQDVHAAIRGQLAAEDAEVAAKVQLLYGGSVKAANAAELFGMPDIDGGLIGGASLNAD
EFGAICRAAGN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgccctatggtagctggtaactggaagatgcacggtacccgcgctagcgtcgct
gagctgaccgaaggcttgagcaatctcgccttgccgagcggagtggaagtcgcggtattt
ccaccagccctgttcatcaatcaagtgatcgatggcttggcgggtaaagaaattactgtc
ggcgcacagaattctgctgtacaacccgaacagggtgcgctgaccggggaagttgctccg
gagcagctggttgaagcaggttgcaagttggtgttgattggtcactcggagcgtcgccaa
gtcattggtgaaaccgacgaagtgctcaatcgcaagtttgcagcggcccaggccaaaggt
ttgaagccagtgctttgcatcggggaaacccttgaagagcgcgaggctggcaaaacgctt
gaagttgtcgggcgtcaactaagcagtatcatcgaagcattcggtgttaaggcttttgcc
aatgcagtaatcgcctatgagcctgtatgggccatcggcactggccttacggccacgcca
cagcaggcccaggatgtgcacgccgccatccgcggccagctggcggcagaagatgctgaa
gtagctgcgaaggtgcagttgctctacggcggcagcgtgaaggcggccaatgcggccgaa
ctgttcggcatgccggatatcgatgggggtctcattggtggggcttccctgaacgcagac
gaattcggtgcaatttgtcgcgccgcaggaaactga

DBGET integrated database retrieval system