KEGG   Pseudomonas putida GB-1: PputGB1_5048Help
Entry
PputGB1_5048      CDS       T00650                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ppg  Pseudomonas putida GB-1
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ppg00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ppg00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5638104..5639108
Genome map
AA seq 334 aa AA seqDB search
MTPIDAKRPLQLNDQGQLRHFLSLDGLPRELLTEILDTADSFLEVGARAVKKVPLLRGKT
VCNVFFENSTRTRTTFELAAQRLSADVISLNVSTSSTSKGETLFDTLRNLEAMAADMFVV
RHSDSGAAHFIAEHVCPDVAVINGGDGRHAHPTQGMLDMLTIRRHKGSFENLSVAIVGDI
LHSRVARSDMLALKALGCPDIRVIGPKTLIPIGIEQYGVKVYTDLAEGLKDVDVVIMLRL
QRERMAGGLLPSEGEFYRLFGLTTARLAGAKPDAIVMHPGPINRGVEIESAVADGKHSVI
LNQVTYGIAVRMAVLSMAMSGQNAQRQFDQENAQ
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacgccaatcgacgccaagcgcccgctgcagctcaatgatcagggccagctgcgccac
ttcctctcgctcgacggtttgccccgcgaactgctcaccgagattctcgacaccgccgac
tccttcctggaagtcggtgcccgggccgtgaaaaaagtcccgctgctgcgcggcaagacc
gtatgcaacgtgttcttcgagaactcgacccgtacccgtaccaccttcgaactggcggcc
cagcgcctgtcggccgacgtgatcagcctgaacgtgtcgacctcctcgaccagcaagggc
gaaacgctgttcgacaccctgcgcaaccttgaagccatggcggccgatatgttcgtcgtg
cgccactccgactcgggcgccgcgcacttcatcgccgaacatgtgtgcccggacgttgcc
gtgatcaacggcggtgacggccgccacgcgcacccgacccagggcatgctcgacatgctc
accatccgccgccacaagggcagcttcgaaaacctgtcggtggccatcgtcggtgacatc
ctgcattcgcgcgtggcccgctccgacatgctcgcgctcaaagcgctgggttgcccggac
attcgcgtgatcggcccgaaaaccctgatcccgatcggtatcgagcagtacggcgtaaag
gtctacaccgacctcgccgaaggcctgaaagacgtcgacgtggtgatcatgctgcgtctg
cagcgtgagcgcatggccggtggcctgctacccagcgaaggcgagttctaccgcctgttc
ggcctgaccaccgcacgcctggccggggccaagcccgacgccatcgtcatgcacccaggc
ccgatcaaccgaggtgtcgaaatcgagtctgcagtggccgacggcaagcactcggtgatc
ctcaaccaggtcacctacggcatcgccgtgcgcatggccgtgttgtccatggccatgagc
gggcagaacgcgcaacgtcaattcgaccaggagaacgcccagtga

DBGET integrated database retrieval system