KEGG   Pseudomonas putida GB-1: PputGB1_5338Help
Entry
PputGB1_5338      CDS       T00650                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg00010  Glycolysis / Gluconeogenesis
ppg00030  Pentose phosphate pathway
ppg00051  Fructose and mannose metabolism
ppg00052  Galactose metabolism
ppg00230  Purine metabolism
ppg00500  Starch and sucrose metabolism
ppg00520  Amino sugar and nucleotide sugar metabolism
ppg00521  Streptomycin biosynthesis
ppg01100  Metabolic pathways
ppg01110  Biosynthesis of secondary metabolites
ppg01120  Microbial metabolism in diverse environments
ppg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PputGB1_5338
   00030 Pentose phosphate pathway
    PputGB1_5338
   00051 Fructose and mannose metabolism
    PputGB1_5338
   00052 Galactose metabolism
    PputGB1_5338
   00500 Starch and sucrose metabolism
    PputGB1_5338
   00520 Amino sugar and nucleotide sugar metabolism
    PputGB1_5338
  Nucleotide metabolism
   00230 Purine metabolism
    PputGB1_5338
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PputGB1_5338
Enzymes [BR:ppg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PputGB1_5338
    5.4.2.8  phosphomannomutase
     PputGB1_5338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: ABZ01220
JGI: PputGB15338
UniProt: B0KQ90
Position
5961952..5963352
Genome map
AA seq 466 aa AA seqDB search
MNDMAHLVPAALPDSIFRAYDIRGVVGKTLHADTAYWIGRAIGAQSLAQGEPQVSVGRDG
RLSGPMLVEQLIKGLVDAGCQVSDVGLVPTPALYYAANVLAGKSGVMLTGSHNPSDYNGF
KIVIAGDTLANEQIQALLTRLKTNDLTLAQGRVEKVEILDRYFQQIVGDVKLAKKLKVVV
DCGNGAAGVIAPQLIEALGCEVIPLFCEVDGNFPNHHPDPGKPENLEDLIAKVKETGADI
GLAFDGDGDRVGVVTNTGSIVYPDRLLMLFAQDVLARNPGAEIIFDVKCTRRLTPLIEQH
GGRALMWKTGHSLIKKKMKQTGSLLAGEMSGHIFIKERWYGFDDGIYSAARLLEILSKAG
QSAENLFAAFPNDISTPEINIDVTDEGKFSIIDALQRDADWGEASLTTIDGVRVDYAHGW
GLVRASNTTPVLVLRFEADSDAELQRIKDVFRTQLLRVEPELQLPF
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacatggcccacctggtccccgccgcactaccagacagcattttccgcgcgtat
gacattcgcggcgtggtcggcaaaacccttcatgccgataccgcctactggatcggccgc
gccatcggtgcacagagcctggcccagggcgaaccgcaggtttcggtagggcgcgatggc
cgcctgtcgggcccgatgctggtcgaacagctgatcaaaggcctggtcgatgccggttgc
caggtcagcgacgttggcctggtacccaccccggcgctgtactacgcggccaatgtgctg
gccggcaagtccggcgtgatgctgaccggcagccacaacccgtcggactacaacggtttc
aagatcgtcattgccggcgacaccctggccaacgagcagatccaggccctgctgacccgc
ctgaaaaccaacgacctgaccctggcccaaggccgcgtggaaaaggtcgagatccttgac
cgctacttccagcagatcgtcggcgacgtaaagctggcgaaaaagctcaaggtggtggtg
gactgcggcaacggcgccgccggcgtgatcgcaccgcagctgatcgaagccctgggctgc
gaagtgatcccgctgttctgcgaggtcgacggcaacttccccaaccaccacccagaccca
ggcaagccggaaaacctcgaagacctgatcgccaaggtcaaggaaaccggcgctgacatc
ggcctggccttcgacggtgacggcgaccgcgtcggcgtggtgaccaacacgggcagcatc
gtctaccccgaccgcctgctgatgctgtttgcccaggatgtactggcgcgcaaccccggt
gccgagattatcttcgacgtcaaatgcacccgtcgcctgaccccgctgatcgagcaacac
ggcggccgcgcgctgatgtggaagaccggccattcgttgatcaagaagaagatgaaacag
accggttcgctgctggccggcgaaatgagcggtcacatcttcatcaaggaacgctggtac
ggttttgacgacggcatctacagcgccgcgcgcctgctggagatcctcagcaaggccggg
cagagcgccgaaaacctgtttgccgccttcccgaacgatatttccacgccggaaatcaat
attgatgtgaccgacgagggtaaattcagcatcattgatgcactgcaacgcgacgccgac
tggggcgaagccagcctgaccaccatcgacggtgtgcgggtggactacgcccacggctgg
ggcctggttcgcgcctccaacaccaccccggtgctggtgctgcgcttcgaggccgacagc
gacgccgaattgcaacgtatcaaggatgtattccgtacccagttgctgcgggttgagcct
gagctgcaactgccgttctga

DBGET integrated database retrieval system