KEGG   Pelodictyon phaeoclathratiforme: Ppha_0229Help
Entry
Ppha_0229         CDS       T00731                                 

Definition
MCP methyltransferase/methylesterase (EC:2.1.1.80 3.1.1.61)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pph02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pph02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
220139..223555
Genome map
AA seq 1138 aa AA seqDB search
MVYALKLMRIMTKEPSGNLKAKKLDGVTLKAANNCFPIVGIGASAGGLEALEIFLKNVPS
RCGIAFVIVQHLDPTHKGIMVELLQRVTDIPVVQVRDRLKIEPDHVYVIPPNKDMSLLHG
VLHLLAPVEPRGLRLPIDFFFRSLADDLQQQSIGVILSGMGSDGSHGLRAIKENGGGVFV
QAPSSAKFDGMPRSAIEAGRVDVIAPVEELPAKIITYLRHFPLLPLQQDPPLEERALSGL
EKVVILLRTHTGQDFSLYKKSTIYRRIERRMGIHQIEKIADYVRFLQENPHETDLLFKEL
LIGVTSFFRDPAVWEILKLKAIPALLAAHPAGGVLRAWVVGCSSGEEAYSLAIIFKEAVA
SVKPLGNFKLQIFATDLDKDAIDKARTGCFPLNISAEVSTERLQRFFERDNNSYRILREI
RETVVFAPQNVIMDPPFTKLDILVCRNLLIYMEPELQKKLFPLFHYTLNPGGILFLGSAE
SLGSFTSLFKPIDGKTRLFSKLHHGVRPEPLALPFSFAHSLPVPQDVAIDQPKSKSSAIN
LQSMTDQFLLEHYTPAAVLTNDKGDIIYISGHTGKYLEPAAGKANWNIFAMAREGLRYEL
NLMFGNALRQQGVATKRGLSVSSNGETQAVNLTIRLLEKPDALHGLVLIVFSDVERVVGG
TLRDPALSVDRGGARQKLLEQELSQARDEILSIREEMQTSQEELKSTNEEMQSANEELQS
TNEELTTSKEEMQSMNEELQTVNHELQSKVSDLSQANNDMKNLLNSTDIATLFLDDALNI
RRFTTRTAAIIKLIASDVGRPITDIVTELHYPALADDAREVLHTLVYSEKQVSASNGRWF
SVKIMPYRTQENRIVGLVITFSDISVAKKLEESLRESEERLRAAIESSGIIVAAVDKEFR
YIWFYDPRHMFHASTSIGMRDEELPGMQNAAELMEIRQKVIATGESVHRDLMLKQADGCR
SFYTLIARPLRDAGGNVIGVITVAADNTARKEAEVAQKESEDRFRLLFDAIPEGALLLDA
KGRIIMVNPEAERILGFSREEMQGKTSSELRWKIVREDGSDFPFEEHPAFVALRTAQPVR
GVIIGVFQPGHNHCRWIRINAQPWFQAGMEAPFQVYMTFVDIKSFRSCPEIKQEENPS
NT seq 3417 nt NT seq  +upstreamnt  +downstreamnt
atggtatacgctcttaaattgatgaggatcatgacgaaagaaccctccggcaaccttaag
gcaaaaaagcttgatggggtcaccctgaaggctgcaaataattgttttcctattgttggt
attggtgcttcagcaggaggattggaggcactggagatttttctgaaaaatgttccttcc
cggtgcggtatcgcctttgtgattgttcagcatcttgatcctactcacaaggggattatg
gtggagttgctgcagcgggttaccgatatcccggtcgttcaggtgagagatcgcctgaaa
attgagccagaccatgtctatgttattcctccaaacaaggacatgtcgttgctgcacgga
gtattgcatctgcttgctccggtagagcctcgagggcttcgtttgcctattgatttcttt
tttcgctcacttgcagatgatttgcaacagcagagtatcggtgtcattctctctggaatg
ggctccgatggaagccatggcttgcgtgctataaaagagaatggtggaggtgtttttgtg
caggcaccctcttcggccaagtttgacggaatgcctcgaagtgccattgaggctggcagg
gttgatgttattgctcccgttgaggagcttcctgctaaaattattacctatctgcggcat
tttccattattacccttacaacaggatcctccgctggaagagagagcgttaagcggtctg
gaaaaagtggtgatactcttgcgaacccataccgggcaggatttttcgctctataaaaaa
agcacgatctatcgccgcattgagcgacgcatgggtattcaccagattgaaaaaatagct
gactatgttcgctttttgcaggaaaacccccatgagactgatctgcttttcaaagaactt
ctgataggggtaaccagttttttccgcgatccggcagtgtgggaaattttgaaactgaag
gcaattccagccctgcttgctgctcatccggctggtggtgttttgcgggcttgggtggta
ggttgttcttctggtgaggaggcctattcccttgcaattatatttaaggaggctgttgca
tcggtcaaacctctcgggaatttcaaattgcagatatttgcaactgacctggataaagat
gctatcgacaaagcccgtacaggatgctttcccttgaacatttcggcagaagtctcaact
gaaaggctgcagcgtttctttgagcgcgacaataatagctatagaatattgcgggagatc
cgtgaaacggtagtgtttgcgccgcagaatgtgatcatggatcccccttttaccaagctc
gatattctggtttgccgaaacctgctgatctatatggagccggagctgcagaaaaagctt
tttccactttttcattacactcttaatcctggaggcattctttttctgggaagtgccgag
agccttggttcatttacctctctttttaaaccgattgatggtaaaacacggcttttcagc
aagcttcaccacggagttcgtccagagccccttgctttgcccttttcatttgcgcactcc
ttgcctgtgcctcaggacgttgcgattgatcagccaaaatcaaaatcctcagccatcaac
ctgcagtccatgacagatcagttcctcctcgaacattatactcctgctgccgtgttgacc
aatgacaagggggatatcatttatatcagcggccatacaggcaagtatcttgaaccggcg
gcaggaaaagccaactggaatatttttgcgatggcacgcgaagggcttcgctatgaactg
aatctcatgttcggcaatgcacttcgtcaacaaggagtggctacaaaaagaggactgagt
gtcagctcgaacggagaaacacaggctgtcaatctgacaatccggcttttggaaaagccg
gatgctttgcatggtctggttttgattgtgttttccgatgtcgaaagggttgtgggagga
acattacgggatccggctctctctgttgacagaggtggagcccggcagaaactgctcgag
caggaattgagtcaggcacgagatgagatcctcagtatccgtgaggagatgcagacttca
caggaggagctcaaatcaaccaatgaagagatgcagtcggccaacgaagaattgcagagc
actaacgaggagctgaccacatcgaaggaagagatgcagtctatgaacgaggagctgcag
acggttaatcacgaactgcaatcaaaggtgagtgatttatcgcaggccaacaatgatatg
aaaaacctgctgaacagtactgatattgcaacactgtttctggacgatgcactcaacatt
cgccgtttcaccacacggacagcggccattatcaaactgattgcaagtgacgtaggacgc
cccataaccgatattgtgacggagttgcattatcccgcattagctgatgatgcacgagag
gttcttcatactcttgtgtacagtgaaaaacaggtttcagccagtaatgggcgttggttc
agcgtgaagattatgccataccgaacacaagaaaaccgcattgtcggtctggtgatcacc
ttcagtgatatcagtgtagcaaaaaagctcgaagagagcctgcgggagagcgaagagcgt
cttcgggcagcaattgaaagttcgggtattatcgtcgctgctgttgacaaggagtttcgt
tatatctggttctatgatccccgccatatgttccatgcatcaacttcaatcggaatgcgg
gatgaggagcttcctgggatgcagaacgccgctgaactgatggaaatcaggcaaaaagtt
attgcaacaggggagagcgtgcacagggatttgatgttgaagcaggccgacggttgccgc
agtttttatacactcattgcaaggcctctgagagatgccggaggtaacgtgatcggagtg
attacagtcgccgcagacaacactgcccgcaaagaggctgaggtggcccagaaagagagt
gaagatcgttttcgccttttgtttgacgcaatacccgagggtgctttacttcttgatgcg
aagggcagaattattatggtaaatccagaggcagaacgtattttgggcttctctcgtgaa
gagatgcaggggaaaacctcttcggagcttcgctggaaaatcgttcgggaagatggttct
gattttccgttcgaagagcatccggcctttgtcgcattgcgtaccgcccagcccgtcagg
ggagtcattatcggtgtgtttcaacccggacacaatcattgccgatggatccgcatcaat
gcacagccatggttccaggcaggaatggaagcaccttttcaggtttacatgacgtttgtc
gatatcaaatcttttcggtcttgtccggaaattaagcaggaggaaaacccttcatga

DBGET integrated database retrieval system