KEGG   Pelodictyon phaeoclathratiforme: Ppha_0335Help
Entry
Ppha_0335         CDS       T00731                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ppha_0335
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ppha_0335
   00052 Galactose metabolism
    Ppha_0335
   00500 Starch and sucrose metabolism
    Ppha_0335
   00520 Amino sugar and nucleotide sugar metabolism
    Ppha_0335
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ppha_0335
   00524 Butirosin and neomycin biosynthesis
    Ppha_0335
Enzymes [BR:pph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Ppha_0335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
321992..322975
Genome map
AA seq 327 aa AA seqDB search
MSRWAIGVDLGGTGIKAAIVGEESGILTKQRALTDTVSGPTGIVGQLAAIITDLYHVASE
TLDVADFAGVGLGAPGAVDAEKGILSYPPNLPGWTVFPLRDELQKLLRQKEELSIPVFLD
NDANVAAFGEAVYGAGREFRDFLMVTLGTGVGGGIVLNRKLYRGPHGTAGEVGFMIIDFE
SPIFHADICGTLESLIGKKAIVALACKMIKASKSDSRLARLYNRDHSRISPRKLEHAALS
GDAVALAVWERVGTILGVGLANVTALMDIRKFVIGGGIAAAGNLVFDPALDQLRRSTLPS
MHEGLELVPAHLGNKAGIYGAAALCFG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgttgggcaattggtgtcgatctcggaggtaccggaatcaaggctgcaatcgtt
ggtgaagagagtggaattctgacgaaacagagagctctcaccgatacggtgtccggcccg
acagggatcgtcgggcagcttgcggctattattaccgatctttaccatgttgcttccgag
acacttgatgttgctgattttgctggtgtcggattaggggcgccgggagcggtcgatgcc
gagaaaggcatactgagctaccctcccaaccttcctggatggacggtctttcccctgcgt
gacgaactgcagaagctgctgcgccaaaaggaagagctttcaattccggtttttctcgat
aatgatgccaacgttgcagcgttcggcgaagcggtctatggcgctggccgtgagtttcgc
gattttctcatggtgaccctcggaaccggtgttggaggaggaattgttctcaacaggaag
ctttatcgaggccctcatggaactgccggtgaggttggcttcatgatcattgattttgaa
agtcccatttttcacgccgatatatgcgggacgcttgagagccttatcggtaaaaaggca
attgtagctcttgcctgtaaaatgatcaaggcgagcaagtcagattcccgtcttgctcgt
ctgtataaccgcgatcatagcaggatttcaccacgcaagcttgaacatgcagctttgtca
ggagatgctgttgctcttgcggtatgggagagggttggtaccattcttggcgtagggctt
gcaaacgttaccgctctgatggatatcagaaaatttgtgatcggcggaggaattgccgcc
gccggaaaccttgtcttcgatcctgccctcgaccagctcaggcgctcaacccttccctcc
atgcatgaagggctggaactggtgccggcgcatcttggcaacaaggctggtatctatggc
gcagcagcattatgcttcggctaa

DBGET integrated database retrieval system