KEGG   Pelodictyon phaeoclathratiforme: Ppha_0717Help
Entry
Ppha_0717         CDS       T00731                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:pph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ppha_0717
   01230 Biosynthesis of amino acids
    Ppha_0717
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ppha_0717
   00030 Pentose phosphate pathway
    Ppha_0717
   00051 Fructose and mannose metabolism
    Ppha_0717
   00052 Galactose metabolism
    Ppha_0717
  Energy metabolism
   00680 Methane metabolism
    Ppha_0717
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Ppha_0717
Enzymes [BR:pph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ppha_0717
Protein phosphatases and associated proteins [BR:pph01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ppha_0717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(745871..747076)
Genome map
AA seq 401 aa AA seqDB search
MKKIGILTSGGDCGGLNAVLKGAAMMALSKGLELYIIPNGYAGLYNLVDQESIVRLDQVR
LDRFDASFAGSEAGHSRVKIKAISNPEKYNRIKAGMKKFDIDALVISGGDDSGSVMVDLN
QQGIQCIHAPKTMDLDLQTYSVGADSTINRIAQFVHDLKTTGKTHNRVLVTEVFGRYAGH
TAFRSGVAAEADCILIPEIPANWDIVYEHLAERFTRRIRESDVHSGTYTIVVAEGLKNAD
GSDIVDESAGIDAFGHKKLAGAGKFTCQQIQKRMKADPAMPIFMKETGMFVEGVYEIPEV
REIHPGHLVRSGNSSAYDINFGFEAGAAAILLLLDGKTGVTISKVKGRKVEFIESSKAIV
QRHVDLDQVALYESLGICFGRKASAYEPILREVEGVYERIY
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaattggtatcctcacaagcggtggggattgcggcggacttaatgcggtgctg
aaaggcgcagcaatgatggctctctcaaaagggctggaactttatatcattcctaacggc
tatgccggtttgtacaacctcgtcgaccaggagagcattgtccggctcgaccaggttcgg
ctcgaccggtttgacgcaagttttgccggctccgaagcaggtcattcgagagtcaagatc
aaggcgattagcaatcctgaaaaatacaaccgcatcaaggccggtatgaaaaaattcgac
attgatgcacttgttatcagtggaggagacgattcaggcagcgtcatggtcgatttaaac
cagcagggcattcagtgcatccatgcaccgaaaaccatggatctcgacctccagacctat
tcggtcggcgccgactcaaccatcaaccgcatcgcacaatttgtgcatgaccttaaaacg
acgggtaaaacccacaacagggttctggtcacggaagtattcggccgttatgcaggccat
acggccttccgcagcggtgtagcggctgaagctgactgtattctcatacccgagattccg
gcaaactgggatattgtttacgaacacctcgcagagcgctttacccgcagaatcagggag
agcgatgtccacagcggaacctataccattgttgttgcagagggactgaaaaatgctgac
ggcagtgatattgtcgatgagtccgcaggcattgatgcattcggtcacaaaaaactcgcc
ggagcggggaaatttacctgccagcagattcagaaaagaatgaaagctgacccggccatg
ccaattttcatgaaagagaccggcatgttcgttgaaggtgtctatgaaattccggaagta
cgtgaaattcatcccggccaccttgtccgttcaggcaactcttcagcatacgacatcaac
ttcggttttgaagccggtgcagcagccatactgctcctgctcgatggcaaaaccggcgtc
accatctccaaggtcaagggacgtaaagtagagttcattgaatcaagcaaggcgattgtg
caacgccatgttgatctcgatcaggtcgccttgtacgagtcactcggcatctgtttcggc
agaaaggccagcgcctacgaaccgattctgcgtgaagtcgaaggcgtttacgaaagaatc
tactga

DBGET integrated database retrieval system